commit 81847ac9b2e311825a270eb3a660685e90aaa90c
parent dbf703ee7f1f418725bb768d8f6248cbce1e27c9
Author: Martin Schanzenbach <schanzen@gnunet.org>
Date: Wed, 29 Apr 2026 06:58:53 +0200
build: update and start vendoring dependencies
Diffstat:
110 files changed, 28442 insertions(+), 6 deletions(-)
diff --git a/flake.nix b/flake.nix
@@ -14,12 +14,12 @@
{
# This defines (installable) package derivations
# For use in flakes that use this flake as input in order
- # to specify/use gnunet from git as a dependency
+ # to specify/use mailbox from git as a dependency
packages = forEachSystem (system:
let
pkgs = nixpkgsFor.${system};
in {
- gnunet = pkgs.stdenv.mkDerivation {
+ mailbox = pkgs.stdenv.mkDerivation {
name = "taler-mailbox";
src = ./.;
buildInputs = [
@@ -32,9 +32,9 @@
};
}
);
- defaultPackage = forEachSystem (system: self.packages.${system}.gnunet);
+ defaultPackage = forEachSystem (system: self.packages.${system}.mailbox);
# This defines a development shell in which you can compile
- # (and use) gnunet
+ # (and use) mailbox
devShells = forEachSystem
(system:
let
diff --git a/go.mod b/go.mod
@@ -4,10 +4,10 @@ go 1.25.0
require (
github.com/gorilla/mux v1.8.1
- github.com/lib/pq v1.12.0
+ github.com/lib/pq v1.12.3
github.com/schanzen/taler-go v1.5.2
gopkg.in/ini.v1 v1.67.1
rsc.io/getopt v0.0.0-20170811000552-20be20937449
)
-require golang.org/x/text v0.35.0 // indirect
+require golang.org/x/text v0.36.0 // indirect
diff --git a/go.sum b/go.sum
@@ -7,6 +7,8 @@ github.com/lib/pq v1.11.2 h1:x6gxUeu39V0BHZiugWe8LXZYZ+Utk7hSJGThs8sdzfs=
github.com/lib/pq v1.11.2/go.mod h1:/p+8NSbOcwzAEI7wiMXFlgydTwcgTr3OSKMsD2BitpA=
github.com/lib/pq v1.12.0 h1:mC1zeiNamwKBecjHarAr26c/+d8V5w/u4J0I/yASbJo=
github.com/lib/pq v1.12.0/go.mod h1:/p+8NSbOcwzAEI7wiMXFlgydTwcgTr3OSKMsD2BitpA=
+github.com/lib/pq v1.12.3 h1:tTWxr2YLKwIvK90ZXEw8GP7UFHtcbTtty8zsI+YjrfQ=
+github.com/lib/pq v1.12.3/go.mod h1:/p+8NSbOcwzAEI7wiMXFlgydTwcgTr3OSKMsD2BitpA=
github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM=
github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4=
github.com/schanzen/taler-go v1.5.2 h1:Db7jRl+CaJ3ylvxFS/umFOyPxg/qhHj2qKEOzXfNbIM=
@@ -24,6 +26,8 @@ golang.org/x/text v0.34.0 h1:oL/Qq0Kdaqxa1KbNeMKwQq0reLCCaFtqu2eNuSeNHbk=
golang.org/x/text v0.34.0/go.mod h1:homfLqTYRFyVYemLBFl5GgL/DWEiH5wcsQ5gSh1yziA=
golang.org/x/text v0.35.0 h1:JOVx6vVDFokkpaq1AEptVzLTpDe9KGpj5tR4/X+ybL8=
golang.org/x/text v0.35.0/go.mod h1:khi/HExzZJ2pGnjenulevKNX1W67CUy0AsXcNubPGCA=
+golang.org/x/text v0.36.0 h1:JfKh3XmcRPqZPKevfXVpI1wXPTqbkE5f7JA92a55Yxg=
+golang.org/x/text v0.36.0/go.mod h1:NIdBknypM8iqVmPiuco0Dh6P5Jcdk8lJL0CUebqK164=
gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
gopkg.in/ini.v1 v1.67.1 h1:tVBILHy0R6e4wkYOn3XmiITt/hEVH4TFMYvAX2Ytz6k=
gopkg.in/ini.v1 v1.67.1/go.mod h1:x/cyOwCgZqOkJoDIJ3c1KNHMo10+nLGAhh+kn3Zizss=
diff --git a/vendor/github.com/gorilla/mux/.editorconfig b/vendor/github.com/gorilla/mux/.editorconfig
@@ -0,0 +1,20 @@
+; https://editorconfig.org/
+
+root = true
+
+[*]
+insert_final_newline = true
+charset = utf-8
+trim_trailing_whitespace = true
+indent_style = space
+indent_size = 2
+
+[{Makefile,go.mod,go.sum,*.go,.gitmodules}]
+indent_style = tab
+indent_size = 4
+
+[*.md]
+indent_size = 4
+trim_trailing_whitespace = false
+
+eclint_indent_style = unset
+\ No newline at end of file
diff --git a/vendor/github.com/gorilla/mux/.gitignore b/vendor/github.com/gorilla/mux/.gitignore
@@ -0,0 +1 @@
+coverage.coverprofile
diff --git a/vendor/github.com/gorilla/mux/LICENSE b/vendor/github.com/gorilla/mux/LICENSE
@@ -0,0 +1,27 @@
+Copyright (c) 2023 The Gorilla Authors. All rights reserved.
+
+Redistribution and use in source and binary forms, with or without
+modification, are permitted provided that the following conditions are
+met:
+
+ * Redistributions of source code must retain the above copyright
+notice, this list of conditions and the following disclaimer.
+ * Redistributions in binary form must reproduce the above
+copyright notice, this list of conditions and the following disclaimer
+in the documentation and/or other materials provided with the
+distribution.
+ * Neither the name of Google Inc. nor the names of its
+contributors may be used to endorse or promote products derived from
+this software without specific prior written permission.
+
+THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS
+"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT
+LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR
+A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT
+OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL,
+SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT
+LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE,
+DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY
+THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT
+(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE
+OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE.
diff --git a/vendor/github.com/gorilla/mux/README.md b/vendor/github.com/gorilla/mux/README.md
@@ -0,0 +1,812 @@
+# gorilla/mux
+
+
+[](https://codecov.io/github/gorilla/mux)
+[](https://godoc.org/github.com/gorilla/mux)
+[](https://sourcegraph.com/github.com/gorilla/mux?badge)
+
+
+
+
+Package `gorilla/mux` implements a request router and dispatcher for matching incoming requests to
+their respective handler.
+
+The name mux stands for "HTTP request multiplexer". Like the standard `http.ServeMux`, `mux.Router` matches incoming requests against a list of registered routes and calls a handler for the route that matches the URL or other conditions. The main features are:
+
+* It implements the `http.Handler` interface so it is compatible with the standard `http.ServeMux`.
+* Requests can be matched based on URL host, path, path prefix, schemes, header and query values, HTTP methods or using custom matchers.
+* URL hosts, paths and query values can have variables with an optional regular expression.
+* Registered URLs can be built, or "reversed", which helps maintaining references to resources.
+* Routes can be used as subrouters: nested routes are only tested if the parent route matches. This is useful to define groups of routes that share common conditions like a host, a path prefix or other repeated attributes. As a bonus, this optimizes request matching.
+
+---
+
+* [Install](#install)
+* [Examples](#examples)
+* [Matching Routes](#matching-routes)
+* [Static Files](#static-files)
+* [Serving Single Page Applications](#serving-single-page-applications) (e.g. React, Vue, Ember.js, etc.)
+* [Registered URLs](#registered-urls)
+* [Walking Routes](#walking-routes)
+* [Graceful Shutdown](#graceful-shutdown)
+* [Middleware](#middleware)
+* [Handling CORS Requests](#handling-cors-requests)
+* [Testing Handlers](#testing-handlers)
+* [Full Example](#full-example)
+
+---
+
+## Install
+
+With a [correctly configured](https://golang.org/doc/install#testing) Go toolchain:
+
+```sh
+go get -u github.com/gorilla/mux
+```
+
+## Examples
+
+Let's start registering a couple of URL paths and handlers:
+
+```go
+func main() {
+ r := mux.NewRouter()
+ r.HandleFunc("/", HomeHandler)
+ r.HandleFunc("/products", ProductsHandler)
+ r.HandleFunc("/articles", ArticlesHandler)
+ http.Handle("/", r)
+}
+```
+
+Here we register three routes mapping URL paths to handlers. This is equivalent to how `http.HandleFunc()` works: if an incoming request URL matches one of the paths, the corresponding handler is called passing (`http.ResponseWriter`, `*http.Request`) as parameters.
+
+Paths can have variables. They are defined using the format `{name}` or `{name:pattern}`. If a regular expression pattern is not defined, the matched variable will be anything until the next slash. For example:
+
+```go
+r := mux.NewRouter()
+r.HandleFunc("/products/{key}", ProductHandler)
+r.HandleFunc("/articles/{category}/", ArticlesCategoryHandler)
+r.HandleFunc("/articles/{category}/{id:[0-9]+}", ArticleHandler)
+```
+
+The names are used to create a map of route variables which can be retrieved calling `mux.Vars()`:
+
+```go
+func ArticlesCategoryHandler(w http.ResponseWriter, r *http.Request) {
+ vars := mux.Vars(r)
+ w.WriteHeader(http.StatusOK)
+ fmt.Fprintf(w, "Category: %v\n", vars["category"])
+}
+```
+
+And this is all you need to know about the basic usage. More advanced options are explained below.
+
+### Matching Routes
+
+Routes can also be restricted to a domain or subdomain. Just define a host pattern to be matched. They can also have variables:
+
+```go
+r := mux.NewRouter()
+// Only matches if domain is "www.example.com".
+r.Host("www.example.com")
+// Matches a dynamic subdomain.
+r.Host("{subdomain:[a-z]+}.example.com")
+```
+
+There are several other matchers that can be added. To match path prefixes:
+
+```go
+r.PathPrefix("/products/")
+```
+
+...or HTTP methods:
+
+```go
+r.Methods("GET", "POST")
+```
+
+...or URL schemes:
+
+```go
+r.Schemes("https")
+```
+
+...or header values:
+
+```go
+r.Headers("X-Requested-With", "XMLHttpRequest")
+```
+
+...or query values:
+
+```go
+r.Queries("key", "value")
+```
+
+...or to use a custom matcher function:
+
+```go
+r.MatcherFunc(func(r *http.Request, rm *RouteMatch) bool {
+ return r.ProtoMajor == 0
+})
+```
+
+...and finally, it is possible to combine several matchers in a single route:
+
+```go
+r.HandleFunc("/products", ProductsHandler).
+ Host("www.example.com").
+ Methods("GET").
+ Schemes("http")
+```
+
+Routes are tested in the order they were added to the router. If two routes match, the first one wins:
+
+```go
+r := mux.NewRouter()
+r.HandleFunc("/specific", specificHandler)
+r.PathPrefix("/").Handler(catchAllHandler)
+```
+
+Setting the same matching conditions again and again can be boring, so we have a way to group several routes that share the same requirements. We call it "subrouting".
+
+For example, let's say we have several URLs that should only match when the host is `www.example.com`. Create a route for that host and get a "subrouter" from it:
+
+```go
+r := mux.NewRouter()
+s := r.Host("www.example.com").Subrouter()
+```
+
+Then register routes in the subrouter:
+
+```go
+s.HandleFunc("/products/", ProductsHandler)
+s.HandleFunc("/products/{key}", ProductHandler)
+s.HandleFunc("/articles/{category}/{id:[0-9]+}", ArticleHandler)
+```
+
+The three URL paths we registered above will only be tested if the domain is `www.example.com`, because the subrouter is tested first. This is not only convenient, but also optimizes request matching. You can create subrouters combining any attribute matchers accepted by a route.
+
+Subrouters can be used to create domain or path "namespaces": you define subrouters in a central place and then parts of the app can register its paths relatively to a given subrouter.
+
+There's one more thing about subroutes. When a subrouter has a path prefix, the inner routes use it as base for their paths:
+
+```go
+r := mux.NewRouter()
+s := r.PathPrefix("/products").Subrouter()
+// "/products/"
+s.HandleFunc("/", ProductsHandler)
+// "/products/{key}/"
+s.HandleFunc("/{key}/", ProductHandler)
+// "/products/{key}/details"
+s.HandleFunc("/{key}/details", ProductDetailsHandler)
+```
+
+
+### Static Files
+
+Note that the path provided to `PathPrefix()` represents a "wildcard": calling
+`PathPrefix("/static/").Handler(...)` means that the handler will be passed any
+request that matches "/static/\*". This makes it easy to serve static files with mux:
+
+```go
+func main() {
+ var dir string
+
+ flag.StringVar(&dir, "dir", ".", "the directory to serve files from. Defaults to the current dir")
+ flag.Parse()
+ r := mux.NewRouter()
+
+ // This will serve files under http://localhost:8000/static/<filename>
+ r.PathPrefix("/static/").Handler(http.StripPrefix("/static/", http.FileServer(http.Dir(dir))))
+
+ srv := &http.Server{
+ Handler: r,
+ Addr: "127.0.0.1:8000",
+ // Good practice: enforce timeouts for servers you create!
+ WriteTimeout: 15 * time.Second,
+ ReadTimeout: 15 * time.Second,
+ }
+
+ log.Fatal(srv.ListenAndServe())
+}
+```
+
+### Serving Single Page Applications
+
+Most of the time it makes sense to serve your SPA on a separate web server from your API,
+but sometimes it's desirable to serve them both from one place. It's possible to write a simple
+handler for serving your SPA (for use with React Router's [BrowserRouter](https://reacttraining.com/react-router/web/api/BrowserRouter) for example), and leverage
+mux's powerful routing for your API endpoints.
+
+```go
+package main
+
+import (
+ "encoding/json"
+ "log"
+ "net/http"
+ "os"
+ "path/filepath"
+ "time"
+
+ "github.com/gorilla/mux"
+)
+
+// spaHandler implements the http.Handler interface, so we can use it
+// to respond to HTTP requests. The path to the static directory and
+// path to the index file within that static directory are used to
+// serve the SPA in the given static directory.
+type spaHandler struct {
+ staticPath string
+ indexPath string
+}
+
+// ServeHTTP inspects the URL path to locate a file within the static dir
+// on the SPA handler. If a file is found, it will be served. If not, the
+// file located at the index path on the SPA handler will be served. This
+// is suitable behavior for serving an SPA (single page application).
+func (h spaHandler) ServeHTTP(w http.ResponseWriter, r *http.Request) {
+ // Join internally call path.Clean to prevent directory traversal
+ path := filepath.Join(h.staticPath, r.URL.Path)
+
+ // check whether a file exists or is a directory at the given path
+ fi, err := os.Stat(path)
+ if os.IsNotExist(err) || fi.IsDir() {
+ // file does not exist or path is a directory, serve index.html
+ http.ServeFile(w, r, filepath.Join(h.staticPath, h.indexPath))
+ return
+ }
+
+ if err != nil {
+ // if we got an error (that wasn't that the file doesn't exist) stating the
+ // file, return a 500 internal server error and stop
+ http.Error(w, err.Error(), http.StatusInternalServerError)
+ return
+ }
+
+ // otherwise, use http.FileServer to serve the static file
+ http.FileServer(http.Dir(h.staticPath)).ServeHTTP(w, r)
+}
+
+func main() {
+ router := mux.NewRouter()
+
+ router.HandleFunc("/api/health", func(w http.ResponseWriter, r *http.Request) {
+ // an example API handler
+ json.NewEncoder(w).Encode(map[string]bool{"ok": true})
+ })
+
+ spa := spaHandler{staticPath: "build", indexPath: "index.html"}
+ router.PathPrefix("/").Handler(spa)
+
+ srv := &http.Server{
+ Handler: router,
+ Addr: "127.0.0.1:8000",
+ // Good practice: enforce timeouts for servers you create!
+ WriteTimeout: 15 * time.Second,
+ ReadTimeout: 15 * time.Second,
+ }
+
+ log.Fatal(srv.ListenAndServe())
+}
+```
+
+### Registered URLs
+
+Now let's see how to build registered URLs.
+
+Routes can be named. All routes that define a name can have their URLs built, or "reversed". We define a name calling `Name()` on a route. For example:
+
+```go
+r := mux.NewRouter()
+r.HandleFunc("/articles/{category}/{id:[0-9]+}", ArticleHandler).
+ Name("article")
+```
+
+To build a URL, get the route and call the `URL()` method, passing a sequence of key/value pairs for the route variables. For the previous route, we would do:
+
+```go
+url, err := r.Get("article").URL("category", "technology", "id", "42")
+```
+
+...and the result will be a `url.URL` with the following path:
+
+```
+"/articles/technology/42"
+```
+
+This also works for host and query value variables:
+
+```go
+r := mux.NewRouter()
+r.Host("{subdomain}.example.com").
+ Path("/articles/{category}/{id:[0-9]+}").
+ Queries("filter", "{filter}").
+ HandlerFunc(ArticleHandler).
+ Name("article")
+
+// url.String() will be "http://news.example.com/articles/technology/42?filter=gorilla"
+url, err := r.Get("article").URL("subdomain", "news",
+ "category", "technology",
+ "id", "42",
+ "filter", "gorilla")
+```
+
+All variables defined in the route are required, and their values must conform to the corresponding patterns. These requirements guarantee that a generated URL will always match a registered route -- the only exception is for explicitly defined "build-only" routes which never match.
+
+Regex support also exists for matching Headers within a route. For example, we could do:
+
+```go
+r.HeadersRegexp("Content-Type", "application/(text|json)")
+```
+
+...and the route will match both requests with a Content-Type of `application/json` as well as `application/text`
+
+There's also a way to build only the URL host or path for a route: use the methods `URLHost()` or `URLPath()` instead. For the previous route, we would do:
+
+```go
+// "http://news.example.com/"
+host, err := r.Get("article").URLHost("subdomain", "news")
+
+// "/articles/technology/42"
+path, err := r.Get("article").URLPath("category", "technology", "id", "42")
+```
+
+And if you use subrouters, host and path defined separately can be built as well:
+
+```go
+r := mux.NewRouter()
+s := r.Host("{subdomain}.example.com").Subrouter()
+s.Path("/articles/{category}/{id:[0-9]+}").
+ HandlerFunc(ArticleHandler).
+ Name("article")
+
+// "http://news.example.com/articles/technology/42"
+url, err := r.Get("article").URL("subdomain", "news",
+ "category", "technology",
+ "id", "42")
+```
+
+To find all the required variables for a given route when calling `URL()`, the method `GetVarNames()` is available:
+```go
+r := mux.NewRouter()
+r.Host("{domain}").
+ Path("/{group}/{item_id}").
+ Queries("some_data1", "{some_data1}").
+ Queries("some_data2", "{some_data2}").
+ Name("article")
+
+// Will print [domain group item_id some_data1 some_data2] <nil>
+fmt.Println(r.Get("article").GetVarNames())
+
+```
+### Walking Routes
+
+The `Walk` function on `mux.Router` can be used to visit all of the routes that are registered on a router. For example,
+the following prints all of the registered routes:
+
+```go
+package main
+
+import (
+ "fmt"
+ "net/http"
+ "strings"
+
+ "github.com/gorilla/mux"
+)
+
+func handler(w http.ResponseWriter, r *http.Request) {
+ return
+}
+
+func main() {
+ r := mux.NewRouter()
+ r.HandleFunc("/", handler)
+ r.HandleFunc("/products", handler).Methods("POST")
+ r.HandleFunc("/articles", handler).Methods("GET")
+ r.HandleFunc("/articles/{id}", handler).Methods("GET", "PUT")
+ r.HandleFunc("/authors", handler).Queries("surname", "{surname}")
+ err := r.Walk(func(route *mux.Route, router *mux.Router, ancestors []*mux.Route) error {
+ pathTemplate, err := route.GetPathTemplate()
+ if err == nil {
+ fmt.Println("ROUTE:", pathTemplate)
+ }
+ pathRegexp, err := route.GetPathRegexp()
+ if err == nil {
+ fmt.Println("Path regexp:", pathRegexp)
+ }
+ queriesTemplates, err := route.GetQueriesTemplates()
+ if err == nil {
+ fmt.Println("Queries templates:", strings.Join(queriesTemplates, ","))
+ }
+ queriesRegexps, err := route.GetQueriesRegexp()
+ if err == nil {
+ fmt.Println("Queries regexps:", strings.Join(queriesRegexps, ","))
+ }
+ methods, err := route.GetMethods()
+ if err == nil {
+ fmt.Println("Methods:", strings.Join(methods, ","))
+ }
+ fmt.Println()
+ return nil
+ })
+
+ if err != nil {
+ fmt.Println(err)
+ }
+
+ http.Handle("/", r)
+}
+```
+
+### Graceful Shutdown
+
+Go 1.8 introduced the ability to [gracefully shutdown](https://golang.org/doc/go1.8#http_shutdown) a `*http.Server`. Here's how to do that alongside `mux`:
+
+```go
+package main
+
+import (
+ "context"
+ "flag"
+ "log"
+ "net/http"
+ "os"
+ "os/signal"
+ "time"
+
+ "github.com/gorilla/mux"
+)
+
+func main() {
+ var wait time.Duration
+ flag.DurationVar(&wait, "graceful-timeout", time.Second * 15, "the duration for which the server gracefully wait for existing connections to finish - e.g. 15s or 1m")
+ flag.Parse()
+
+ r := mux.NewRouter()
+ // Add your routes as needed
+
+ srv := &http.Server{
+ Addr: "0.0.0.0:8080",
+ // Good practice to set timeouts to avoid Slowloris attacks.
+ WriteTimeout: time.Second * 15,
+ ReadTimeout: time.Second * 15,
+ IdleTimeout: time.Second * 60,
+ Handler: r, // Pass our instance of gorilla/mux in.
+ }
+
+ // Run our server in a goroutine so that it doesn't block.
+ go func() {
+ if err := srv.ListenAndServe(); err != nil {
+ log.Println(err)
+ }
+ }()
+
+ c := make(chan os.Signal, 1)
+ // We'll accept graceful shutdowns when quit via SIGINT (Ctrl+C)
+ // SIGKILL, SIGQUIT or SIGTERM (Ctrl+/) will not be caught.
+ signal.Notify(c, os.Interrupt)
+
+ // Block until we receive our signal.
+ <-c
+
+ // Create a deadline to wait for.
+ ctx, cancel := context.WithTimeout(context.Background(), wait)
+ defer cancel()
+ // Doesn't block if no connections, but will otherwise wait
+ // until the timeout deadline.
+ srv.Shutdown(ctx)
+ // Optionally, you could run srv.Shutdown in a goroutine and block on
+ // <-ctx.Done() if your application should wait for other services
+ // to finalize based on context cancellation.
+ log.Println("shutting down")
+ os.Exit(0)
+}
+```
+
+### Middleware
+
+Mux supports the addition of middlewares to a [Router](https://godoc.org/github.com/gorilla/mux#Router), which are executed in the order they are added if a match is found, including its subrouters.
+Middlewares are (typically) small pieces of code which take one request, do something with it, and pass it down to another middleware or the final handler. Some common use cases for middleware are request logging, header manipulation, or `ResponseWriter` hijacking.
+
+Mux middlewares are defined using the de facto standard type:
+
+```go
+type MiddlewareFunc func(http.Handler) http.Handler
+```
+
+Typically, the returned handler is a closure which does something with the http.ResponseWriter and http.Request passed to it, and then calls the handler passed as parameter to the MiddlewareFunc. This takes advantage of closures being able access variables from the context where they are created, while retaining the signature enforced by the receivers.
+
+A very basic middleware which logs the URI of the request being handled could be written as:
+
+```go
+func loggingMiddleware(next http.Handler) http.Handler {
+ return http.HandlerFunc(func(w http.ResponseWriter, r *http.Request) {
+ // Do stuff here
+ log.Println(r.RequestURI)
+ // Call the next handler, which can be another middleware in the chain, or the final handler.
+ next.ServeHTTP(w, r)
+ })
+}
+```
+
+Middlewares can be added to a router using `Router.Use()`:
+
+```go
+r := mux.NewRouter()
+r.HandleFunc("/", handler)
+r.Use(loggingMiddleware)
+```
+
+A more complex authentication middleware, which maps session token to users, could be written as:
+
+```go
+// Define our struct
+type authenticationMiddleware struct {
+ tokenUsers map[string]string
+}
+
+// Initialize it somewhere
+func (amw *authenticationMiddleware) Populate() {
+ amw.tokenUsers["00000000"] = "user0"
+ amw.tokenUsers["aaaaaaaa"] = "userA"
+ amw.tokenUsers["05f717e5"] = "randomUser"
+ amw.tokenUsers["deadbeef"] = "user0"
+}
+
+// Middleware function, which will be called for each request
+func (amw *authenticationMiddleware) Middleware(next http.Handler) http.Handler {
+ return http.HandlerFunc(func(w http.ResponseWriter, r *http.Request) {
+ token := r.Header.Get("X-Session-Token")
+
+ if user, found := amw.tokenUsers[token]; found {
+ // We found the token in our map
+ log.Printf("Authenticated user %s\n", user)
+ // Pass down the request to the next middleware (or final handler)
+ next.ServeHTTP(w, r)
+ } else {
+ // Write an error and stop the handler chain
+ http.Error(w, "Forbidden", http.StatusForbidden)
+ }
+ })
+}
+```
+
+```go
+r := mux.NewRouter()
+r.HandleFunc("/", handler)
+
+amw := authenticationMiddleware{tokenUsers: make(map[string]string)}
+amw.Populate()
+
+r.Use(amw.Middleware)
+```
+
+Note: The handler chain will be stopped if your middleware doesn't call `next.ServeHTTP()` with the corresponding parameters. This can be used to abort a request if the middleware writer wants to. Middlewares _should_ write to `ResponseWriter` if they _are_ going to terminate the request, and they _should not_ write to `ResponseWriter` if they _are not_ going to terminate it.
+
+### Handling CORS Requests
+
+[CORSMethodMiddleware](https://godoc.org/github.com/gorilla/mux#CORSMethodMiddleware) intends to make it easier to strictly set the `Access-Control-Allow-Methods` response header.
+
+* You will still need to use your own CORS handler to set the other CORS headers such as `Access-Control-Allow-Origin`
+* The middleware will set the `Access-Control-Allow-Methods` header to all the method matchers (e.g. `r.Methods(http.MethodGet, http.MethodPut, http.MethodOptions)` -> `Access-Control-Allow-Methods: GET,PUT,OPTIONS`) on a route
+* If you do not specify any methods, then:
+> _Important_: there must be an `OPTIONS` method matcher for the middleware to set the headers.
+
+Here is an example of using `CORSMethodMiddleware` along with a custom `OPTIONS` handler to set all the required CORS headers:
+
+```go
+package main
+
+import (
+ "net/http"
+ "github.com/gorilla/mux"
+)
+
+func main() {
+ r := mux.NewRouter()
+
+ // IMPORTANT: you must specify an OPTIONS method matcher for the middleware to set CORS headers
+ r.HandleFunc("/foo", fooHandler).Methods(http.MethodGet, http.MethodPut, http.MethodPatch, http.MethodOptions)
+ r.Use(mux.CORSMethodMiddleware(r))
+
+ http.ListenAndServe(":8080", r)
+}
+
+func fooHandler(w http.ResponseWriter, r *http.Request) {
+ w.Header().Set("Access-Control-Allow-Origin", "*")
+ if r.Method == http.MethodOptions {
+ return
+ }
+
+ w.Write([]byte("foo"))
+}
+```
+
+And an request to `/foo` using something like:
+
+```bash
+curl localhost:8080/foo -v
+```
+
+Would look like:
+
+```bash
+* Trying ::1...
+* TCP_NODELAY set
+* Connected to localhost (::1) port 8080 (#0)
+> GET /foo HTTP/1.1
+> Host: localhost:8080
+> User-Agent: curl/7.59.0
+> Accept: */*
+>
+< HTTP/1.1 200 OK
+< Access-Control-Allow-Methods: GET,PUT,PATCH,OPTIONS
+< Access-Control-Allow-Origin: *
+< Date: Fri, 28 Jun 2019 20:13:30 GMT
+< Content-Length: 3
+< Content-Type: text/plain; charset=utf-8
+<
+* Connection #0 to host localhost left intact
+foo
+```
+
+### Testing Handlers
+
+Testing handlers in a Go web application is straightforward, and _mux_ doesn't complicate this any further. Given two files: `endpoints.go` and `endpoints_test.go`, here's how we'd test an application using _mux_.
+
+First, our simple HTTP handler:
+
+```go
+// endpoints.go
+package main
+
+func HealthCheckHandler(w http.ResponseWriter, r *http.Request) {
+ // A very simple health check.
+ w.Header().Set("Content-Type", "application/json")
+ w.WriteHeader(http.StatusOK)
+
+ // In the future we could report back on the status of our DB, or our cache
+ // (e.g. Redis) by performing a simple PING, and include them in the response.
+ io.WriteString(w, `{"alive": true}`)
+}
+
+func main() {
+ r := mux.NewRouter()
+ r.HandleFunc("/health", HealthCheckHandler)
+
+ log.Fatal(http.ListenAndServe("localhost:8080", r))
+}
+```
+
+Our test code:
+
+```go
+// endpoints_test.go
+package main
+
+import (
+ "net/http"
+ "net/http/httptest"
+ "testing"
+)
+
+func TestHealthCheckHandler(t *testing.T) {
+ // Create a request to pass to our handler. We don't have any query parameters for now, so we'll
+ // pass 'nil' as the third parameter.
+ req, err := http.NewRequest("GET", "/health", nil)
+ if err != nil {
+ t.Fatal(err)
+ }
+
+ // We create a ResponseRecorder (which satisfies http.ResponseWriter) to record the response.
+ rr := httptest.NewRecorder()
+ handler := http.HandlerFunc(HealthCheckHandler)
+
+ // Our handlers satisfy http.Handler, so we can call their ServeHTTP method
+ // directly and pass in our Request and ResponseRecorder.
+ handler.ServeHTTP(rr, req)
+
+ // Check the status code is what we expect.
+ if status := rr.Code; status != http.StatusOK {
+ t.Errorf("handler returned wrong status code: got %v want %v",
+ status, http.StatusOK)
+ }
+
+ // Check the response body is what we expect.
+ expected := `{"alive": true}`
+ if rr.Body.String() != expected {
+ t.Errorf("handler returned unexpected body: got %v want %v",
+ rr.Body.String(), expected)
+ }
+}
+```
+
+In the case that our routes have [variables](#examples), we can pass those in the request. We could write
+[table-driven tests](https://dave.cheney.net/2013/06/09/writing-table-driven-tests-in-go) to test multiple
+possible route variables as needed.
+
+```go
+// endpoints.go
+func main() {
+ r := mux.NewRouter()
+ // A route with a route variable:
+ r.HandleFunc("/metrics/{type}", MetricsHandler)
+
+ log.Fatal(http.ListenAndServe("localhost:8080", r))
+}
+```
+
+Our test file, with a table-driven test of `routeVariables`:
+
+```go
+// endpoints_test.go
+func TestMetricsHandler(t *testing.T) {
+ tt := []struct{
+ routeVariable string
+ shouldPass bool
+ }{
+ {"goroutines", true},
+ {"heap", true},
+ {"counters", true},
+ {"queries", true},
+ {"adhadaeqm3k", false},
+ }
+
+ for _, tc := range tt {
+ path := fmt.Sprintf("/metrics/%s", tc.routeVariable)
+ req, err := http.NewRequest("GET", path, nil)
+ if err != nil {
+ t.Fatal(err)
+ }
+
+ rr := httptest.NewRecorder()
+
+ // To add the vars to the context,
+ // we need to create a router through which we can pass the request.
+ router := mux.NewRouter()
+ router.HandleFunc("/metrics/{type}", MetricsHandler)
+ router.ServeHTTP(rr, req)
+
+ // In this case, our MetricsHandler returns a non-200 response
+ // for a route variable it doesn't know about.
+ if rr.Code == http.StatusOK && !tc.shouldPass {
+ t.Errorf("handler should have failed on routeVariable %s: got %v want %v",
+ tc.routeVariable, rr.Code, http.StatusOK)
+ }
+ }
+}
+```
+
+## Full Example
+
+Here's a complete, runnable example of a small `mux` based server:
+
+```go
+package main
+
+import (
+ "net/http"
+ "log"
+ "github.com/gorilla/mux"
+)
+
+func YourHandler(w http.ResponseWriter, r *http.Request) {
+ w.Write([]byte("Gorilla!\n"))
+}
+
+func main() {
+ r := mux.NewRouter()
+ // Routes consist of a path and a handler function.
+ r.HandleFunc("/", YourHandler)
+
+ // Bind to a port and pass our router in
+ log.Fatal(http.ListenAndServe(":8000", r))
+}
+```
+
+## License
+
+BSD licensed. See the LICENSE file for details.
diff --git a/vendor/github.com/gorilla/mux/doc.go b/vendor/github.com/gorilla/mux/doc.go
@@ -0,0 +1,305 @@
+// Copyright 2012 The Gorilla Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+/*
+Package mux implements a request router and dispatcher.
+
+The name mux stands for "HTTP request multiplexer". Like the standard
+http.ServeMux, mux.Router matches incoming requests against a list of
+registered routes and calls a handler for the route that matches the URL
+or other conditions. The main features are:
+
+ - Requests can be matched based on URL host, path, path prefix, schemes,
+ header and query values, HTTP methods or using custom matchers.
+ - URL hosts, paths and query values can have variables with an optional
+ regular expression.
+ - Registered URLs can be built, or "reversed", which helps maintaining
+ references to resources.
+ - Routes can be used as subrouters: nested routes are only tested if the
+ parent route matches. This is useful to define groups of routes that
+ share common conditions like a host, a path prefix or other repeated
+ attributes. As a bonus, this optimizes request matching.
+ - It implements the http.Handler interface so it is compatible with the
+ standard http.ServeMux.
+
+Let's start registering a couple of URL paths and handlers:
+
+ func main() {
+ r := mux.NewRouter()
+ r.HandleFunc("/", HomeHandler)
+ r.HandleFunc("/products", ProductsHandler)
+ r.HandleFunc("/articles", ArticlesHandler)
+ http.Handle("/", r)
+ }
+
+Here we register three routes mapping URL paths to handlers. This is
+equivalent to how http.HandleFunc() works: if an incoming request URL matches
+one of the paths, the corresponding handler is called passing
+(http.ResponseWriter, *http.Request) as parameters.
+
+Paths can have variables. They are defined using the format {name} or
+{name:pattern}. If a regular expression pattern is not defined, the matched
+variable will be anything until the next slash. For example:
+
+ r := mux.NewRouter()
+ r.HandleFunc("/products/{key}", ProductHandler)
+ r.HandleFunc("/articles/{category}/", ArticlesCategoryHandler)
+ r.HandleFunc("/articles/{category}/{id:[0-9]+}", ArticleHandler)
+
+Groups can be used inside patterns, as long as they are non-capturing (?:re). For example:
+
+ r.HandleFunc("/articles/{category}/{sort:(?:asc|desc|new)}", ArticlesCategoryHandler)
+
+The names are used to create a map of route variables which can be retrieved
+calling mux.Vars():
+
+ vars := mux.Vars(request)
+ category := vars["category"]
+
+Note that if any capturing groups are present, mux will panic() during parsing. To prevent
+this, convert any capturing groups to non-capturing, e.g. change "/{sort:(asc|desc)}" to
+"/{sort:(?:asc|desc)}". This is a change from prior versions which behaved unpredictably
+when capturing groups were present.
+
+And this is all you need to know about the basic usage. More advanced options
+are explained below.
+
+Routes can also be restricted to a domain or subdomain. Just define a host
+pattern to be matched. They can also have variables:
+
+ r := mux.NewRouter()
+ // Only matches if domain is "www.example.com".
+ r.Host("www.example.com")
+ // Matches a dynamic subdomain.
+ r.Host("{subdomain:[a-z]+}.domain.com")
+
+There are several other matchers that can be added. To match path prefixes:
+
+ r.PathPrefix("/products/")
+
+...or HTTP methods:
+
+ r.Methods("GET", "POST")
+
+...or URL schemes:
+
+ r.Schemes("https")
+
+...or header values:
+
+ r.Headers("X-Requested-With", "XMLHttpRequest")
+
+...or query values:
+
+ r.Queries("key", "value")
+
+...or to use a custom matcher function:
+
+ r.MatcherFunc(func(r *http.Request, rm *RouteMatch) bool {
+ return r.ProtoMajor == 0
+ })
+
+...and finally, it is possible to combine several matchers in a single route:
+
+ r.HandleFunc("/products", ProductsHandler).
+ Host("www.example.com").
+ Methods("GET").
+ Schemes("http")
+
+Setting the same matching conditions again and again can be boring, so we have
+a way to group several routes that share the same requirements.
+We call it "subrouting".
+
+For example, let's say we have several URLs that should only match when the
+host is "www.example.com". Create a route for that host and get a "subrouter"
+from it:
+
+ r := mux.NewRouter()
+ s := r.Host("www.example.com").Subrouter()
+
+Then register routes in the subrouter:
+
+ s.HandleFunc("/products/", ProductsHandler)
+ s.HandleFunc("/products/{key}", ProductHandler)
+ s.HandleFunc("/articles/{category}/{id:[0-9]+}"), ArticleHandler)
+
+The three URL paths we registered above will only be tested if the domain is
+"www.example.com", because the subrouter is tested first. This is not
+only convenient, but also optimizes request matching. You can create
+subrouters combining any attribute matchers accepted by a route.
+
+Subrouters can be used to create domain or path "namespaces": you define
+subrouters in a central place and then parts of the app can register its
+paths relatively to a given subrouter.
+
+There's one more thing about subroutes. When a subrouter has a path prefix,
+the inner routes use it as base for their paths:
+
+ r := mux.NewRouter()
+ s := r.PathPrefix("/products").Subrouter()
+ // "/products/"
+ s.HandleFunc("/", ProductsHandler)
+ // "/products/{key}/"
+ s.HandleFunc("/{key}/", ProductHandler)
+ // "/products/{key}/details"
+ s.HandleFunc("/{key}/details", ProductDetailsHandler)
+
+Note that the path provided to PathPrefix() represents a "wildcard": calling
+PathPrefix("/static/").Handler(...) means that the handler will be passed any
+request that matches "/static/*". This makes it easy to serve static files with mux:
+
+ func main() {
+ var dir string
+
+ flag.StringVar(&dir, "dir", ".", "the directory to serve files from. Defaults to the current dir")
+ flag.Parse()
+ r := mux.NewRouter()
+
+ // This will serve files under http://localhost:8000/static/<filename>
+ r.PathPrefix("/static/").Handler(http.StripPrefix("/static/", http.FileServer(http.Dir(dir))))
+
+ srv := &http.Server{
+ Handler: r,
+ Addr: "127.0.0.1:8000",
+ // Good practice: enforce timeouts for servers you create!
+ WriteTimeout: 15 * time.Second,
+ ReadTimeout: 15 * time.Second,
+ }
+
+ log.Fatal(srv.ListenAndServe())
+ }
+
+Now let's see how to build registered URLs.
+
+Routes can be named. All routes that define a name can have their URLs built,
+or "reversed". We define a name calling Name() on a route. For example:
+
+ r := mux.NewRouter()
+ r.HandleFunc("/articles/{category}/{id:[0-9]+}", ArticleHandler).
+ Name("article")
+
+To build a URL, get the route and call the URL() method, passing a sequence of
+key/value pairs for the route variables. For the previous route, we would do:
+
+ url, err := r.Get("article").URL("category", "technology", "id", "42")
+
+...and the result will be a url.URL with the following path:
+
+ "/articles/technology/42"
+
+This also works for host and query value variables:
+
+ r := mux.NewRouter()
+ r.Host("{subdomain}.domain.com").
+ Path("/articles/{category}/{id:[0-9]+}").
+ Queries("filter", "{filter}").
+ HandlerFunc(ArticleHandler).
+ Name("article")
+
+ // url.String() will be "http://news.domain.com/articles/technology/42?filter=gorilla"
+ url, err := r.Get("article").URL("subdomain", "news",
+ "category", "technology",
+ "id", "42",
+ "filter", "gorilla")
+
+All variables defined in the route are required, and their values must
+conform to the corresponding patterns. These requirements guarantee that a
+generated URL will always match a registered route -- the only exception is
+for explicitly defined "build-only" routes which never match.
+
+Regex support also exists for matching Headers within a route. For example, we could do:
+
+ r.HeadersRegexp("Content-Type", "application/(text|json)")
+
+...and the route will match both requests with a Content-Type of `application/json` as well as
+`application/text`
+
+There's also a way to build only the URL host or path for a route:
+use the methods URLHost() or URLPath() instead. For the previous route,
+we would do:
+
+ // "http://news.domain.com/"
+ host, err := r.Get("article").URLHost("subdomain", "news")
+
+ // "/articles/technology/42"
+ path, err := r.Get("article").URLPath("category", "technology", "id", "42")
+
+And if you use subrouters, host and path defined separately can be built
+as well:
+
+ r := mux.NewRouter()
+ s := r.Host("{subdomain}.domain.com").Subrouter()
+ s.Path("/articles/{category}/{id:[0-9]+}").
+ HandlerFunc(ArticleHandler).
+ Name("article")
+
+ // "http://news.domain.com/articles/technology/42"
+ url, err := r.Get("article").URL("subdomain", "news",
+ "category", "technology",
+ "id", "42")
+
+Mux supports the addition of middlewares to a Router, which are executed in the order they are added if a match is found, including its subrouters. Middlewares are (typically) small pieces of code which take one request, do something with it, and pass it down to another middleware or the final handler. Some common use cases for middleware are request logging, header manipulation, or ResponseWriter hijacking.
+
+ type MiddlewareFunc func(http.Handler) http.Handler
+
+Typically, the returned handler is a closure which does something with the http.ResponseWriter and http.Request passed to it, and then calls the handler passed as parameter to the MiddlewareFunc (closures can access variables from the context where they are created).
+
+A very basic middleware which logs the URI of the request being handled could be written as:
+
+ func simpleMw(next http.Handler) http.Handler {
+ return http.HandlerFunc(func(w http.ResponseWriter, r *http.Request) {
+ // Do stuff here
+ log.Println(r.RequestURI)
+ // Call the next handler, which can be another middleware in the chain, or the final handler.
+ next.ServeHTTP(w, r)
+ })
+ }
+
+Middlewares can be added to a router using `Router.Use()`:
+
+ r := mux.NewRouter()
+ r.HandleFunc("/", handler)
+ r.Use(simpleMw)
+
+A more complex authentication middleware, which maps session token to users, could be written as:
+
+ // Define our struct
+ type authenticationMiddleware struct {
+ tokenUsers map[string]string
+ }
+
+ // Initialize it somewhere
+ func (amw *authenticationMiddleware) Populate() {
+ amw.tokenUsers["00000000"] = "user0"
+ amw.tokenUsers["aaaaaaaa"] = "userA"
+ amw.tokenUsers["05f717e5"] = "randomUser"
+ amw.tokenUsers["deadbeef"] = "user0"
+ }
+
+ // Middleware function, which will be called for each request
+ func (amw *authenticationMiddleware) Middleware(next http.Handler) http.Handler {
+ return http.HandlerFunc(func(w http.ResponseWriter, r *http.Request) {
+ token := r.Header.Get("X-Session-Token")
+
+ if user, found := amw.tokenUsers[token]; found {
+ // We found the token in our map
+ log.Printf("Authenticated user %s\n", user)
+ next.ServeHTTP(w, r)
+ } else {
+ http.Error(w, "Forbidden", http.StatusForbidden)
+ }
+ })
+ }
+
+ r := mux.NewRouter()
+ r.HandleFunc("/", handler)
+
+ amw := authenticationMiddleware{tokenUsers: make(map[string]string)}
+ amw.Populate()
+
+ r.Use(amw.Middleware)
+
+Note: The handler chain will be stopped if your middleware doesn't call `next.ServeHTTP()` with the corresponding parameters. This can be used to abort a request if the middleware writer wants to.
+*/
+package mux
diff --git a/vendor/github.com/gorilla/mux/middleware.go b/vendor/github.com/gorilla/mux/middleware.go
@@ -0,0 +1,74 @@
+package mux
+
+import (
+ "net/http"
+ "strings"
+)
+
+// MiddlewareFunc is a function which receives an http.Handler and returns another http.Handler.
+// Typically, the returned handler is a closure which does something with the http.ResponseWriter and http.Request passed
+// to it, and then calls the handler passed as parameter to the MiddlewareFunc.
+type MiddlewareFunc func(http.Handler) http.Handler
+
+// middleware interface is anything which implements a MiddlewareFunc named Middleware.
+type middleware interface {
+ Middleware(handler http.Handler) http.Handler
+}
+
+// Middleware allows MiddlewareFunc to implement the middleware interface.
+func (mw MiddlewareFunc) Middleware(handler http.Handler) http.Handler {
+ return mw(handler)
+}
+
+// Use appends a MiddlewareFunc to the chain. Middleware can be used to intercept or otherwise modify requests and/or responses, and are executed in the order that they are applied to the Router.
+func (r *Router) Use(mwf ...MiddlewareFunc) {
+ for _, fn := range mwf {
+ r.middlewares = append(r.middlewares, fn)
+ }
+}
+
+// useInterface appends a middleware to the chain. Middleware can be used to intercept or otherwise modify requests and/or responses, and are executed in the order that they are applied to the Router.
+func (r *Router) useInterface(mw middleware) {
+ r.middlewares = append(r.middlewares, mw)
+}
+
+// CORSMethodMiddleware automatically sets the Access-Control-Allow-Methods response header
+// on requests for routes that have an OPTIONS method matcher to all the method matchers on
+// the route. Routes that do not explicitly handle OPTIONS requests will not be processed
+// by the middleware. See examples for usage.
+func CORSMethodMiddleware(r *Router) MiddlewareFunc {
+ return func(next http.Handler) http.Handler {
+ return http.HandlerFunc(func(w http.ResponseWriter, req *http.Request) {
+ allMethods, err := getAllMethodsForRoute(r, req)
+ if err == nil {
+ for _, v := range allMethods {
+ if v == http.MethodOptions {
+ w.Header().Set("Access-Control-Allow-Methods", strings.Join(allMethods, ","))
+ }
+ }
+ }
+
+ next.ServeHTTP(w, req)
+ })
+ }
+}
+
+// getAllMethodsForRoute returns all the methods from method matchers matching a given
+// request.
+func getAllMethodsForRoute(r *Router, req *http.Request) ([]string, error) {
+ var allMethods []string
+
+ for _, route := range r.routes {
+ var match RouteMatch
+ if route.Match(req, &match) || match.MatchErr == ErrMethodMismatch {
+ methods, err := route.GetMethods()
+ if err != nil {
+ return nil, err
+ }
+
+ allMethods = append(allMethods, methods...)
+ }
+ }
+
+ return allMethods, nil
+}
diff --git a/vendor/github.com/gorilla/mux/mux.go b/vendor/github.com/gorilla/mux/mux.go
@@ -0,0 +1,608 @@
+// Copyright 2012 The Gorilla Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package mux
+
+import (
+ "context"
+ "errors"
+ "fmt"
+ "net/http"
+ "path"
+ "regexp"
+)
+
+var (
+ // ErrMethodMismatch is returned when the method in the request does not match
+ // the method defined against the route.
+ ErrMethodMismatch = errors.New("method is not allowed")
+ // ErrNotFound is returned when no route match is found.
+ ErrNotFound = errors.New("no matching route was found")
+)
+
+// NewRouter returns a new router instance.
+func NewRouter() *Router {
+ return &Router{namedRoutes: make(map[string]*Route)}
+}
+
+// Router registers routes to be matched and dispatches a handler.
+//
+// It implements the http.Handler interface, so it can be registered to serve
+// requests:
+//
+// var router = mux.NewRouter()
+//
+// func main() {
+// http.Handle("/", router)
+// }
+//
+// Or, for Google App Engine, register it in a init() function:
+//
+// func init() {
+// http.Handle("/", router)
+// }
+//
+// This will send all incoming requests to the router.
+type Router struct {
+ // Configurable Handler to be used when no route matches.
+ // This can be used to render your own 404 Not Found errors.
+ NotFoundHandler http.Handler
+
+ // Configurable Handler to be used when the request method does not match the route.
+ // This can be used to render your own 405 Method Not Allowed errors.
+ MethodNotAllowedHandler http.Handler
+
+ // Routes to be matched, in order.
+ routes []*Route
+
+ // Routes by name for URL building.
+ namedRoutes map[string]*Route
+
+ // If true, do not clear the request context after handling the request.
+ //
+ // Deprecated: No effect, since the context is stored on the request itself.
+ KeepContext bool
+
+ // Slice of middlewares to be called after a match is found
+ middlewares []middleware
+
+ // configuration shared with `Route`
+ routeConf
+}
+
+// common route configuration shared between `Router` and `Route`
+type routeConf struct {
+ // If true, "/path/foo%2Fbar/to" will match the path "/path/{var}/to"
+ useEncodedPath bool
+
+ // If true, when the path pattern is "/path/", accessing "/path" will
+ // redirect to the former and vice versa.
+ strictSlash bool
+
+ // If true, when the path pattern is "/path//to", accessing "/path//to"
+ // will not redirect
+ skipClean bool
+
+ // Manager for the variables from host and path.
+ regexp routeRegexpGroup
+
+ // List of matchers.
+ matchers []matcher
+
+ // The scheme used when building URLs.
+ buildScheme string
+
+ buildVarsFunc BuildVarsFunc
+}
+
+// returns an effective deep copy of `routeConf`
+func copyRouteConf(r routeConf) routeConf {
+ c := r
+
+ if r.regexp.path != nil {
+ c.regexp.path = copyRouteRegexp(r.regexp.path)
+ }
+
+ if r.regexp.host != nil {
+ c.regexp.host = copyRouteRegexp(r.regexp.host)
+ }
+
+ c.regexp.queries = make([]*routeRegexp, 0, len(r.regexp.queries))
+ for _, q := range r.regexp.queries {
+ c.regexp.queries = append(c.regexp.queries, copyRouteRegexp(q))
+ }
+
+ c.matchers = make([]matcher, len(r.matchers))
+ copy(c.matchers, r.matchers)
+
+ return c
+}
+
+func copyRouteRegexp(r *routeRegexp) *routeRegexp {
+ c := *r
+ return &c
+}
+
+// Match attempts to match the given request against the router's registered routes.
+//
+// If the request matches a route of this router or one of its subrouters the Route,
+// Handler, and Vars fields of the the match argument are filled and this function
+// returns true.
+//
+// If the request does not match any of this router's or its subrouters' routes
+// then this function returns false. If available, a reason for the match failure
+// will be filled in the match argument's MatchErr field. If the match failure type
+// (eg: not found) has a registered handler, the handler is assigned to the Handler
+// field of the match argument.
+func (r *Router) Match(req *http.Request, match *RouteMatch) bool {
+ for _, route := range r.routes {
+ if route.Match(req, match) {
+ // Build middleware chain if no error was found
+ if match.MatchErr == nil {
+ for i := len(r.middlewares) - 1; i >= 0; i-- {
+ match.Handler = r.middlewares[i].Middleware(match.Handler)
+ }
+ }
+ return true
+ }
+ }
+
+ if match.MatchErr == ErrMethodMismatch {
+ if r.MethodNotAllowedHandler != nil {
+ match.Handler = r.MethodNotAllowedHandler
+ return true
+ }
+
+ return false
+ }
+
+ // Closest match for a router (includes sub-routers)
+ if r.NotFoundHandler != nil {
+ match.Handler = r.NotFoundHandler
+ match.MatchErr = ErrNotFound
+ return true
+ }
+
+ match.MatchErr = ErrNotFound
+ return false
+}
+
+// ServeHTTP dispatches the handler registered in the matched route.
+//
+// When there is a match, the route variables can be retrieved calling
+// mux.Vars(request).
+func (r *Router) ServeHTTP(w http.ResponseWriter, req *http.Request) {
+ if !r.skipClean {
+ path := req.URL.Path
+ if r.useEncodedPath {
+ path = req.URL.EscapedPath()
+ }
+ // Clean path to canonical form and redirect.
+ if p := cleanPath(path); p != path {
+
+ // Added 3 lines (Philip Schlump) - It was dropping the query string and #whatever from query.
+ // This matches with fix in go 1.2 r.c. 4 for same problem. Go Issue:
+ // http://code.google.com/p/go/issues/detail?id=5252
+ url := *req.URL
+ url.Path = p
+ p = url.String()
+
+ w.Header().Set("Location", p)
+ w.WriteHeader(http.StatusMovedPermanently)
+ return
+ }
+ }
+ var match RouteMatch
+ var handler http.Handler
+ if r.Match(req, &match) {
+ handler = match.Handler
+ req = requestWithVars(req, match.Vars)
+ req = requestWithRoute(req, match.Route)
+ }
+
+ if handler == nil && match.MatchErr == ErrMethodMismatch {
+ handler = methodNotAllowedHandler()
+ }
+
+ if handler == nil {
+ handler = http.NotFoundHandler()
+ }
+
+ handler.ServeHTTP(w, req)
+}
+
+// Get returns a route registered with the given name.
+func (r *Router) Get(name string) *Route {
+ return r.namedRoutes[name]
+}
+
+// GetRoute returns a route registered with the given name. This method
+// was renamed to Get() and remains here for backwards compatibility.
+func (r *Router) GetRoute(name string) *Route {
+ return r.namedRoutes[name]
+}
+
+// StrictSlash defines the trailing slash behavior for new routes. The initial
+// value is false.
+//
+// When true, if the route path is "/path/", accessing "/path" will perform a redirect
+// to the former and vice versa. In other words, your application will always
+// see the path as specified in the route.
+//
+// When false, if the route path is "/path", accessing "/path/" will not match
+// this route and vice versa.
+//
+// The re-direct is a HTTP 301 (Moved Permanently). Note that when this is set for
+// routes with a non-idempotent method (e.g. POST, PUT), the subsequent re-directed
+// request will be made as a GET by most clients. Use middleware or client settings
+// to modify this behaviour as needed.
+//
+// Special case: when a route sets a path prefix using the PathPrefix() method,
+// strict slash is ignored for that route because the redirect behavior can't
+// be determined from a prefix alone. However, any subrouters created from that
+// route inherit the original StrictSlash setting.
+func (r *Router) StrictSlash(value bool) *Router {
+ r.strictSlash = value
+ return r
+}
+
+// SkipClean defines the path cleaning behaviour for new routes. The initial
+// value is false. Users should be careful about which routes are not cleaned
+//
+// When true, if the route path is "/path//to", it will remain with the double
+// slash. This is helpful if you have a route like: /fetch/http://xkcd.com/534/
+//
+// When false, the path will be cleaned, so /fetch/http://xkcd.com/534/ will
+// become /fetch/http/xkcd.com/534
+func (r *Router) SkipClean(value bool) *Router {
+ r.skipClean = value
+ return r
+}
+
+// UseEncodedPath tells the router to match the encoded original path
+// to the routes.
+// For eg. "/path/foo%2Fbar/to" will match the path "/path/{var}/to".
+//
+// If not called, the router will match the unencoded path to the routes.
+// For eg. "/path/foo%2Fbar/to" will match the path "/path/foo/bar/to"
+func (r *Router) UseEncodedPath() *Router {
+ r.useEncodedPath = true
+ return r
+}
+
+// ----------------------------------------------------------------------------
+// Route factories
+// ----------------------------------------------------------------------------
+
+// NewRoute registers an empty route.
+func (r *Router) NewRoute() *Route {
+ // initialize a route with a copy of the parent router's configuration
+ route := &Route{routeConf: copyRouteConf(r.routeConf), namedRoutes: r.namedRoutes}
+ r.routes = append(r.routes, route)
+ return route
+}
+
+// Name registers a new route with a name.
+// See Route.Name().
+func (r *Router) Name(name string) *Route {
+ return r.NewRoute().Name(name)
+}
+
+// Handle registers a new route with a matcher for the URL path.
+// See Route.Path() and Route.Handler().
+func (r *Router) Handle(path string, handler http.Handler) *Route {
+ return r.NewRoute().Path(path).Handler(handler)
+}
+
+// HandleFunc registers a new route with a matcher for the URL path.
+// See Route.Path() and Route.HandlerFunc().
+func (r *Router) HandleFunc(path string, f func(http.ResponseWriter,
+ *http.Request)) *Route {
+ return r.NewRoute().Path(path).HandlerFunc(f)
+}
+
+// Headers registers a new route with a matcher for request header values.
+// See Route.Headers().
+func (r *Router) Headers(pairs ...string) *Route {
+ return r.NewRoute().Headers(pairs...)
+}
+
+// Host registers a new route with a matcher for the URL host.
+// See Route.Host().
+func (r *Router) Host(tpl string) *Route {
+ return r.NewRoute().Host(tpl)
+}
+
+// MatcherFunc registers a new route with a custom matcher function.
+// See Route.MatcherFunc().
+func (r *Router) MatcherFunc(f MatcherFunc) *Route {
+ return r.NewRoute().MatcherFunc(f)
+}
+
+// Methods registers a new route with a matcher for HTTP methods.
+// See Route.Methods().
+func (r *Router) Methods(methods ...string) *Route {
+ return r.NewRoute().Methods(methods...)
+}
+
+// Path registers a new route with a matcher for the URL path.
+// See Route.Path().
+func (r *Router) Path(tpl string) *Route {
+ return r.NewRoute().Path(tpl)
+}
+
+// PathPrefix registers a new route with a matcher for the URL path prefix.
+// See Route.PathPrefix().
+func (r *Router) PathPrefix(tpl string) *Route {
+ return r.NewRoute().PathPrefix(tpl)
+}
+
+// Queries registers a new route with a matcher for URL query values.
+// See Route.Queries().
+func (r *Router) Queries(pairs ...string) *Route {
+ return r.NewRoute().Queries(pairs...)
+}
+
+// Schemes registers a new route with a matcher for URL schemes.
+// See Route.Schemes().
+func (r *Router) Schemes(schemes ...string) *Route {
+ return r.NewRoute().Schemes(schemes...)
+}
+
+// BuildVarsFunc registers a new route with a custom function for modifying
+// route variables before building a URL.
+func (r *Router) BuildVarsFunc(f BuildVarsFunc) *Route {
+ return r.NewRoute().BuildVarsFunc(f)
+}
+
+// Walk walks the router and all its sub-routers, calling walkFn for each route
+// in the tree. The routes are walked in the order they were added. Sub-routers
+// are explored depth-first.
+func (r *Router) Walk(walkFn WalkFunc) error {
+ return r.walk(walkFn, []*Route{})
+}
+
+// SkipRouter is used as a return value from WalkFuncs to indicate that the
+// router that walk is about to descend down to should be skipped.
+var SkipRouter = errors.New("skip this router")
+
+// WalkFunc is the type of the function called for each route visited by Walk.
+// At every invocation, it is given the current route, and the current router,
+// and a list of ancestor routes that lead to the current route.
+type WalkFunc func(route *Route, router *Router, ancestors []*Route) error
+
+func (r *Router) walk(walkFn WalkFunc, ancestors []*Route) error {
+ for _, t := range r.routes {
+ err := walkFn(t, r, ancestors)
+ if err == SkipRouter {
+ continue
+ }
+ if err != nil {
+ return err
+ }
+ for _, sr := range t.matchers {
+ if h, ok := sr.(*Router); ok {
+ ancestors = append(ancestors, t)
+ err := h.walk(walkFn, ancestors)
+ if err != nil {
+ return err
+ }
+ ancestors = ancestors[:len(ancestors)-1]
+ }
+ }
+ if h, ok := t.handler.(*Router); ok {
+ ancestors = append(ancestors, t)
+ err := h.walk(walkFn, ancestors)
+ if err != nil {
+ return err
+ }
+ ancestors = ancestors[:len(ancestors)-1]
+ }
+ }
+ return nil
+}
+
+// ----------------------------------------------------------------------------
+// Context
+// ----------------------------------------------------------------------------
+
+// RouteMatch stores information about a matched route.
+type RouteMatch struct {
+ Route *Route
+ Handler http.Handler
+ Vars map[string]string
+
+ // MatchErr is set to appropriate matching error
+ // It is set to ErrMethodMismatch if there is a mismatch in
+ // the request method and route method
+ MatchErr error
+}
+
+type contextKey int
+
+const (
+ varsKey contextKey = iota
+ routeKey
+)
+
+// Vars returns the route variables for the current request, if any.
+func Vars(r *http.Request) map[string]string {
+ if rv := r.Context().Value(varsKey); rv != nil {
+ return rv.(map[string]string)
+ }
+ return nil
+}
+
+// CurrentRoute returns the matched route for the current request, if any.
+// This only works when called inside the handler of the matched route
+// because the matched route is stored in the request context which is cleared
+// after the handler returns.
+func CurrentRoute(r *http.Request) *Route {
+ if rv := r.Context().Value(routeKey); rv != nil {
+ return rv.(*Route)
+ }
+ return nil
+}
+
+func requestWithVars(r *http.Request, vars map[string]string) *http.Request {
+ ctx := context.WithValue(r.Context(), varsKey, vars)
+ return r.WithContext(ctx)
+}
+
+func requestWithRoute(r *http.Request, route *Route) *http.Request {
+ ctx := context.WithValue(r.Context(), routeKey, route)
+ return r.WithContext(ctx)
+}
+
+// ----------------------------------------------------------------------------
+// Helpers
+// ----------------------------------------------------------------------------
+
+// cleanPath returns the canonical path for p, eliminating . and .. elements.
+// Borrowed from the net/http package.
+func cleanPath(p string) string {
+ if p == "" {
+ return "/"
+ }
+ if p[0] != '/' {
+ p = "/" + p
+ }
+ np := path.Clean(p)
+ // path.Clean removes trailing slash except for root;
+ // put the trailing slash back if necessary.
+ if p[len(p)-1] == '/' && np != "/" {
+ np += "/"
+ }
+
+ return np
+}
+
+// uniqueVars returns an error if two slices contain duplicated strings.
+func uniqueVars(s1, s2 []string) error {
+ for _, v1 := range s1 {
+ for _, v2 := range s2 {
+ if v1 == v2 {
+ return fmt.Errorf("mux: duplicated route variable %q", v2)
+ }
+ }
+ }
+ return nil
+}
+
+// checkPairs returns the count of strings passed in, and an error if
+// the count is not an even number.
+func checkPairs(pairs ...string) (int, error) {
+ length := len(pairs)
+ if length%2 != 0 {
+ return length, fmt.Errorf(
+ "mux: number of parameters must be multiple of 2, got %v", pairs)
+ }
+ return length, nil
+}
+
+// mapFromPairsToString converts variadic string parameters to a
+// string to string map.
+func mapFromPairsToString(pairs ...string) (map[string]string, error) {
+ length, err := checkPairs(pairs...)
+ if err != nil {
+ return nil, err
+ }
+ m := make(map[string]string, length/2)
+ for i := 0; i < length; i += 2 {
+ m[pairs[i]] = pairs[i+1]
+ }
+ return m, nil
+}
+
+// mapFromPairsToRegex converts variadic string parameters to a
+// string to regex map.
+func mapFromPairsToRegex(pairs ...string) (map[string]*regexp.Regexp, error) {
+ length, err := checkPairs(pairs...)
+ if err != nil {
+ return nil, err
+ }
+ m := make(map[string]*regexp.Regexp, length/2)
+ for i := 0; i < length; i += 2 {
+ regex, err := regexp.Compile(pairs[i+1])
+ if err != nil {
+ return nil, err
+ }
+ m[pairs[i]] = regex
+ }
+ return m, nil
+}
+
+// matchInArray returns true if the given string value is in the array.
+func matchInArray(arr []string, value string) bool {
+ for _, v := range arr {
+ if v == value {
+ return true
+ }
+ }
+ return false
+}
+
+// matchMapWithString returns true if the given key/value pairs exist in a given map.
+func matchMapWithString(toCheck map[string]string, toMatch map[string][]string, canonicalKey bool) bool {
+ for k, v := range toCheck {
+ // Check if key exists.
+ if canonicalKey {
+ k = http.CanonicalHeaderKey(k)
+ }
+ if values := toMatch[k]; values == nil {
+ return false
+ } else if v != "" {
+ // If value was defined as an empty string we only check that the
+ // key exists. Otherwise we also check for equality.
+ valueExists := false
+ for _, value := range values {
+ if v == value {
+ valueExists = true
+ break
+ }
+ }
+ if !valueExists {
+ return false
+ }
+ }
+ }
+ return true
+}
+
+// matchMapWithRegex returns true if the given key/value pairs exist in a given map compiled against
+// the given regex
+func matchMapWithRegex(toCheck map[string]*regexp.Regexp, toMatch map[string][]string, canonicalKey bool) bool {
+ for k, v := range toCheck {
+ // Check if key exists.
+ if canonicalKey {
+ k = http.CanonicalHeaderKey(k)
+ }
+ if values := toMatch[k]; values == nil {
+ return false
+ } else if v != nil {
+ // If value was defined as an empty string we only check that the
+ // key exists. Otherwise we also check for equality.
+ valueExists := false
+ for _, value := range values {
+ if v.MatchString(value) {
+ valueExists = true
+ break
+ }
+ }
+ if !valueExists {
+ return false
+ }
+ }
+ }
+ return true
+}
+
+// methodNotAllowed replies to the request with an HTTP status code 405.
+func methodNotAllowed(w http.ResponseWriter, r *http.Request) {
+ w.WriteHeader(http.StatusMethodNotAllowed)
+}
+
+// methodNotAllowedHandler returns a simple request handler
+// that replies to each request with a status code 405.
+func methodNotAllowedHandler() http.Handler { return http.HandlerFunc(methodNotAllowed) }
diff --git a/vendor/github.com/gorilla/mux/regexp.go b/vendor/github.com/gorilla/mux/regexp.go
@@ -0,0 +1,388 @@
+// Copyright 2012 The Gorilla Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package mux
+
+import (
+ "bytes"
+ "fmt"
+ "net/http"
+ "net/url"
+ "regexp"
+ "strconv"
+ "strings"
+)
+
+type routeRegexpOptions struct {
+ strictSlash bool
+ useEncodedPath bool
+}
+
+type regexpType int
+
+const (
+ regexpTypePath regexpType = iota
+ regexpTypeHost
+ regexpTypePrefix
+ regexpTypeQuery
+)
+
+// newRouteRegexp parses a route template and returns a routeRegexp,
+// used to match a host, a path or a query string.
+//
+// It will extract named variables, assemble a regexp to be matched, create
+// a "reverse" template to build URLs and compile regexps to validate variable
+// values used in URL building.
+//
+// Previously we accepted only Python-like identifiers for variable
+// names ([a-zA-Z_][a-zA-Z0-9_]*), but currently the only restriction is that
+// name and pattern can't be empty, and names can't contain a colon.
+func newRouteRegexp(tpl string, typ regexpType, options routeRegexpOptions) (*routeRegexp, error) {
+ // Check if it is well-formed.
+ idxs, errBraces := braceIndices(tpl)
+ if errBraces != nil {
+ return nil, errBraces
+ }
+ // Backup the original.
+ template := tpl
+ // Now let's parse it.
+ defaultPattern := "[^/]+"
+ if typ == regexpTypeQuery {
+ defaultPattern = ".*"
+ } else if typ == regexpTypeHost {
+ defaultPattern = "[^.]+"
+ }
+ // Only match strict slash if not matching
+ if typ != regexpTypePath {
+ options.strictSlash = false
+ }
+ // Set a flag for strictSlash.
+ endSlash := false
+ if options.strictSlash && strings.HasSuffix(tpl, "/") {
+ tpl = tpl[:len(tpl)-1]
+ endSlash = true
+ }
+ varsN := make([]string, len(idxs)/2)
+ varsR := make([]*regexp.Regexp, len(idxs)/2)
+ pattern := bytes.NewBufferString("")
+ pattern.WriteByte('^')
+ reverse := bytes.NewBufferString("")
+ var end int
+ var err error
+ for i := 0; i < len(idxs); i += 2 {
+ // Set all values we are interested in.
+ raw := tpl[end:idxs[i]]
+ end = idxs[i+1]
+ parts := strings.SplitN(tpl[idxs[i]+1:end-1], ":", 2)
+ name := parts[0]
+ patt := defaultPattern
+ if len(parts) == 2 {
+ patt = parts[1]
+ }
+ // Name or pattern can't be empty.
+ if name == "" || patt == "" {
+ return nil, fmt.Errorf("mux: missing name or pattern in %q",
+ tpl[idxs[i]:end])
+ }
+ // Build the regexp pattern.
+ fmt.Fprintf(pattern, "%s(?P<%s>%s)", regexp.QuoteMeta(raw), varGroupName(i/2), patt)
+
+ // Build the reverse template.
+ fmt.Fprintf(reverse, "%s%%s", raw)
+
+ // Append variable name and compiled pattern.
+ varsN[i/2] = name
+ varsR[i/2], err = regexp.Compile(fmt.Sprintf("^%s$", patt))
+ if err != nil {
+ return nil, err
+ }
+ }
+ // Add the remaining.
+ raw := tpl[end:]
+ pattern.WriteString(regexp.QuoteMeta(raw))
+ if options.strictSlash {
+ pattern.WriteString("[/]?")
+ }
+ if typ == regexpTypeQuery {
+ // Add the default pattern if the query value is empty
+ if queryVal := strings.SplitN(template, "=", 2)[1]; queryVal == "" {
+ pattern.WriteString(defaultPattern)
+ }
+ }
+ if typ != regexpTypePrefix {
+ pattern.WriteByte('$')
+ }
+
+ var wildcardHostPort bool
+ if typ == regexpTypeHost {
+ if !strings.Contains(pattern.String(), ":") {
+ wildcardHostPort = true
+ }
+ }
+ reverse.WriteString(raw)
+ if endSlash {
+ reverse.WriteByte('/')
+ }
+ // Compile full regexp.
+ reg, errCompile := regexp.Compile(pattern.String())
+ if errCompile != nil {
+ return nil, errCompile
+ }
+
+ // Check for capturing groups which used to work in older versions
+ if reg.NumSubexp() != len(idxs)/2 {
+ panic(fmt.Sprintf("route %s contains capture groups in its regexp. ", template) +
+ "Only non-capturing groups are accepted: e.g. (?:pattern) instead of (pattern)")
+ }
+
+ // Done!
+ return &routeRegexp{
+ template: template,
+ regexpType: typ,
+ options: options,
+ regexp: reg,
+ reverse: reverse.String(),
+ varsN: varsN,
+ varsR: varsR,
+ wildcardHostPort: wildcardHostPort,
+ }, nil
+}
+
+// routeRegexp stores a regexp to match a host or path and information to
+// collect and validate route variables.
+type routeRegexp struct {
+ // The unmodified template.
+ template string
+ // The type of match
+ regexpType regexpType
+ // Options for matching
+ options routeRegexpOptions
+ // Expanded regexp.
+ regexp *regexp.Regexp
+ // Reverse template.
+ reverse string
+ // Variable names.
+ varsN []string
+ // Variable regexps (validators).
+ varsR []*regexp.Regexp
+ // Wildcard host-port (no strict port match in hostname)
+ wildcardHostPort bool
+}
+
+// Match matches the regexp against the URL host or path.
+func (r *routeRegexp) Match(req *http.Request, match *RouteMatch) bool {
+ if r.regexpType == regexpTypeHost {
+ host := getHost(req)
+ if r.wildcardHostPort {
+ // Don't be strict on the port match
+ if i := strings.Index(host, ":"); i != -1 {
+ host = host[:i]
+ }
+ }
+ return r.regexp.MatchString(host)
+ }
+
+ if r.regexpType == regexpTypeQuery {
+ return r.matchQueryString(req)
+ }
+ path := req.URL.Path
+ if r.options.useEncodedPath {
+ path = req.URL.EscapedPath()
+ }
+ return r.regexp.MatchString(path)
+}
+
+// url builds a URL part using the given values.
+func (r *routeRegexp) url(values map[string]string) (string, error) {
+ urlValues := make([]interface{}, len(r.varsN))
+ for k, v := range r.varsN {
+ value, ok := values[v]
+ if !ok {
+ return "", fmt.Errorf("mux: missing route variable %q", v)
+ }
+ if r.regexpType == regexpTypeQuery {
+ value = url.QueryEscape(value)
+ }
+ urlValues[k] = value
+ }
+ rv := fmt.Sprintf(r.reverse, urlValues...)
+ if !r.regexp.MatchString(rv) {
+ // The URL is checked against the full regexp, instead of checking
+ // individual variables. This is faster but to provide a good error
+ // message, we check individual regexps if the URL doesn't match.
+ for k, v := range r.varsN {
+ if !r.varsR[k].MatchString(values[v]) {
+ return "", fmt.Errorf(
+ "mux: variable %q doesn't match, expected %q", values[v],
+ r.varsR[k].String())
+ }
+ }
+ }
+ return rv, nil
+}
+
+// getURLQuery returns a single query parameter from a request URL.
+// For a URL with foo=bar&baz=ding, we return only the relevant key
+// value pair for the routeRegexp.
+func (r *routeRegexp) getURLQuery(req *http.Request) string {
+ if r.regexpType != regexpTypeQuery {
+ return ""
+ }
+ templateKey := strings.SplitN(r.template, "=", 2)[0]
+ val, ok := findFirstQueryKey(req.URL.RawQuery, templateKey)
+ if ok {
+ return templateKey + "=" + val
+ }
+ return ""
+}
+
+// findFirstQueryKey returns the same result as (*url.URL).Query()[key][0].
+// If key was not found, empty string and false is returned.
+func findFirstQueryKey(rawQuery, key string) (value string, ok bool) {
+ query := []byte(rawQuery)
+ for len(query) > 0 {
+ foundKey := query
+ if i := bytes.IndexAny(foundKey, "&;"); i >= 0 {
+ foundKey, query = foundKey[:i], foundKey[i+1:]
+ } else {
+ query = query[:0]
+ }
+ if len(foundKey) == 0 {
+ continue
+ }
+ var value []byte
+ if i := bytes.IndexByte(foundKey, '='); i >= 0 {
+ foundKey, value = foundKey[:i], foundKey[i+1:]
+ }
+ if len(foundKey) < len(key) {
+ // Cannot possibly be key.
+ continue
+ }
+ keyString, err := url.QueryUnescape(string(foundKey))
+ if err != nil {
+ continue
+ }
+ if keyString != key {
+ continue
+ }
+ valueString, err := url.QueryUnescape(string(value))
+ if err != nil {
+ continue
+ }
+ return valueString, true
+ }
+ return "", false
+}
+
+func (r *routeRegexp) matchQueryString(req *http.Request) bool {
+ return r.regexp.MatchString(r.getURLQuery(req))
+}
+
+// braceIndices returns the first level curly brace indices from a string.
+// It returns an error in case of unbalanced braces.
+func braceIndices(s string) ([]int, error) {
+ var level, idx int
+ var idxs []int
+ for i := 0; i < len(s); i++ {
+ switch s[i] {
+ case '{':
+ if level++; level == 1 {
+ idx = i
+ }
+ case '}':
+ if level--; level == 0 {
+ idxs = append(idxs, idx, i+1)
+ } else if level < 0 {
+ return nil, fmt.Errorf("mux: unbalanced braces in %q", s)
+ }
+ }
+ }
+ if level != 0 {
+ return nil, fmt.Errorf("mux: unbalanced braces in %q", s)
+ }
+ return idxs, nil
+}
+
+// varGroupName builds a capturing group name for the indexed variable.
+func varGroupName(idx int) string {
+ return "v" + strconv.Itoa(idx)
+}
+
+// ----------------------------------------------------------------------------
+// routeRegexpGroup
+// ----------------------------------------------------------------------------
+
+// routeRegexpGroup groups the route matchers that carry variables.
+type routeRegexpGroup struct {
+ host *routeRegexp
+ path *routeRegexp
+ queries []*routeRegexp
+}
+
+// setMatch extracts the variables from the URL once a route matches.
+func (v routeRegexpGroup) setMatch(req *http.Request, m *RouteMatch, r *Route) {
+ // Store host variables.
+ if v.host != nil {
+ host := getHost(req)
+ if v.host.wildcardHostPort {
+ // Don't be strict on the port match
+ if i := strings.Index(host, ":"); i != -1 {
+ host = host[:i]
+ }
+ }
+ matches := v.host.regexp.FindStringSubmatchIndex(host)
+ if len(matches) > 0 {
+ extractVars(host, matches, v.host.varsN, m.Vars)
+ }
+ }
+ path := req.URL.Path
+ if r.useEncodedPath {
+ path = req.URL.EscapedPath()
+ }
+ // Store path variables.
+ if v.path != nil {
+ matches := v.path.regexp.FindStringSubmatchIndex(path)
+ if len(matches) > 0 {
+ extractVars(path, matches, v.path.varsN, m.Vars)
+ // Check if we should redirect.
+ if v.path.options.strictSlash {
+ p1 := strings.HasSuffix(path, "/")
+ p2 := strings.HasSuffix(v.path.template, "/")
+ if p1 != p2 {
+ u, _ := url.Parse(req.URL.String())
+ if p1 {
+ u.Path = u.Path[:len(u.Path)-1]
+ } else {
+ u.Path += "/"
+ }
+ m.Handler = http.RedirectHandler(u.String(), http.StatusMovedPermanently)
+ }
+ }
+ }
+ }
+ // Store query string variables.
+ for _, q := range v.queries {
+ queryURL := q.getURLQuery(req)
+ matches := q.regexp.FindStringSubmatchIndex(queryURL)
+ if len(matches) > 0 {
+ extractVars(queryURL, matches, q.varsN, m.Vars)
+ }
+ }
+}
+
+// getHost tries its best to return the request host.
+// According to section 14.23 of RFC 2616 the Host header
+// can include the port number if the default value of 80 is not used.
+func getHost(r *http.Request) string {
+ if r.URL.IsAbs() {
+ return r.URL.Host
+ }
+ return r.Host
+}
+
+func extractVars(input string, matches []int, names []string, output map[string]string) {
+ for i, name := range names {
+ output[name] = input[matches[2*i+2]:matches[2*i+3]]
+ }
+}
diff --git a/vendor/github.com/gorilla/mux/route.go b/vendor/github.com/gorilla/mux/route.go
@@ -0,0 +1,765 @@
+// Copyright 2012 The Gorilla Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package mux
+
+import (
+ "errors"
+ "fmt"
+ "net/http"
+ "net/url"
+ "regexp"
+ "strings"
+)
+
+// Route stores information to match a request and build URLs.
+type Route struct {
+ // Request handler for the route.
+ handler http.Handler
+ // If true, this route never matches: it is only used to build URLs.
+ buildOnly bool
+ // The name used to build URLs.
+ name string
+ // Error resulted from building a route.
+ err error
+
+ // "global" reference to all named routes
+ namedRoutes map[string]*Route
+
+ // config possibly passed in from `Router`
+ routeConf
+}
+
+// SkipClean reports whether path cleaning is enabled for this route via
+// Router.SkipClean.
+func (r *Route) SkipClean() bool {
+ return r.skipClean
+}
+
+// Match matches the route against the request.
+func (r *Route) Match(req *http.Request, match *RouteMatch) bool {
+ if r.buildOnly || r.err != nil {
+ return false
+ }
+
+ var matchErr error
+
+ // Match everything.
+ for _, m := range r.matchers {
+ if matched := m.Match(req, match); !matched {
+ if _, ok := m.(methodMatcher); ok {
+ matchErr = ErrMethodMismatch
+ continue
+ }
+
+ // Ignore ErrNotFound errors. These errors arise from match call
+ // to Subrouters.
+ //
+ // This prevents subsequent matching subrouters from failing to
+ // run middleware. If not ignored, the middleware would see a
+ // non-nil MatchErr and be skipped, even when there was a
+ // matching route.
+ if match.MatchErr == ErrNotFound {
+ match.MatchErr = nil
+ }
+
+ matchErr = nil // nolint:ineffassign
+ return false
+ } else {
+ // Multiple routes may share the same path but use different HTTP methods. For instance:
+ // Route 1: POST "/users/{id}".
+ // Route 2: GET "/users/{id}", parameters: "id": "[0-9]+".
+ //
+ // The router must handle these cases correctly. For a GET request to "/users/abc" with "id" as "-2",
+ // The router should return a "Not Found" error as no route fully matches this request.
+ if match.MatchErr == ErrMethodMismatch {
+ match.MatchErr = nil
+ }
+ }
+ }
+
+ if matchErr != nil {
+ match.MatchErr = matchErr
+ return false
+ }
+
+ if match.MatchErr == ErrMethodMismatch && r.handler != nil {
+ // We found a route which matches request method, clear MatchErr
+ match.MatchErr = nil
+ // Then override the mis-matched handler
+ match.Handler = r.handler
+ }
+
+ // Yay, we have a match. Let's collect some info about it.
+ if match.Route == nil {
+ match.Route = r
+ }
+ if match.Handler == nil {
+ match.Handler = r.handler
+ }
+ if match.Vars == nil {
+ match.Vars = make(map[string]string)
+ }
+
+ // Set variables.
+ r.regexp.setMatch(req, match, r)
+ return true
+}
+
+// ----------------------------------------------------------------------------
+// Route attributes
+// ----------------------------------------------------------------------------
+
+// GetError returns an error resulted from building the route, if any.
+func (r *Route) GetError() error {
+ return r.err
+}
+
+// BuildOnly sets the route to never match: it is only used to build URLs.
+func (r *Route) BuildOnly() *Route {
+ r.buildOnly = true
+ return r
+}
+
+// Handler --------------------------------------------------------------------
+
+// Handler sets a handler for the route.
+func (r *Route) Handler(handler http.Handler) *Route {
+ if r.err == nil {
+ r.handler = handler
+ }
+ return r
+}
+
+// HandlerFunc sets a handler function for the route.
+func (r *Route) HandlerFunc(f func(http.ResponseWriter, *http.Request)) *Route {
+ return r.Handler(http.HandlerFunc(f))
+}
+
+// GetHandler returns the handler for the route, if any.
+func (r *Route) GetHandler() http.Handler {
+ return r.handler
+}
+
+// Name -----------------------------------------------------------------------
+
+// Name sets the name for the route, used to build URLs.
+// It is an error to call Name more than once on a route.
+func (r *Route) Name(name string) *Route {
+ if r.name != "" {
+ r.err = fmt.Errorf("mux: route already has name %q, can't set %q",
+ r.name, name)
+ }
+ if r.err == nil {
+ r.name = name
+ r.namedRoutes[name] = r
+ }
+ return r
+}
+
+// GetName returns the name for the route, if any.
+func (r *Route) GetName() string {
+ return r.name
+}
+
+// ----------------------------------------------------------------------------
+// Matchers
+// ----------------------------------------------------------------------------
+
+// matcher types try to match a request.
+type matcher interface {
+ Match(*http.Request, *RouteMatch) bool
+}
+
+// addMatcher adds a matcher to the route.
+func (r *Route) addMatcher(m matcher) *Route {
+ if r.err == nil {
+ r.matchers = append(r.matchers, m)
+ }
+ return r
+}
+
+// addRegexpMatcher adds a host or path matcher and builder to a route.
+func (r *Route) addRegexpMatcher(tpl string, typ regexpType) error {
+ if r.err != nil {
+ return r.err
+ }
+ if typ == regexpTypePath || typ == regexpTypePrefix {
+ if len(tpl) > 0 && tpl[0] != '/' {
+ return fmt.Errorf("mux: path must start with a slash, got %q", tpl)
+ }
+ if r.regexp.path != nil {
+ tpl = strings.TrimRight(r.regexp.path.template, "/") + tpl
+ }
+ }
+ rr, err := newRouteRegexp(tpl, typ, routeRegexpOptions{
+ strictSlash: r.strictSlash,
+ useEncodedPath: r.useEncodedPath,
+ })
+ if err != nil {
+ return err
+ }
+ for _, q := range r.regexp.queries {
+ if err = uniqueVars(rr.varsN, q.varsN); err != nil {
+ return err
+ }
+ }
+ if typ == regexpTypeHost {
+ if r.regexp.path != nil {
+ if err = uniqueVars(rr.varsN, r.regexp.path.varsN); err != nil {
+ return err
+ }
+ }
+ r.regexp.host = rr
+ } else {
+ if r.regexp.host != nil {
+ if err = uniqueVars(rr.varsN, r.regexp.host.varsN); err != nil {
+ return err
+ }
+ }
+ if typ == regexpTypeQuery {
+ r.regexp.queries = append(r.regexp.queries, rr)
+ } else {
+ r.regexp.path = rr
+ }
+ }
+ r.addMatcher(rr)
+ return nil
+}
+
+// Headers --------------------------------------------------------------------
+
+// headerMatcher matches the request against header values.
+type headerMatcher map[string]string
+
+func (m headerMatcher) Match(r *http.Request, match *RouteMatch) bool {
+ return matchMapWithString(m, r.Header, true)
+}
+
+// Headers adds a matcher for request header values.
+// It accepts a sequence of key/value pairs to be matched. For example:
+//
+// r := mux.NewRouter().NewRoute()
+// r.Headers("Content-Type", "application/json",
+// "X-Requested-With", "XMLHttpRequest")
+//
+// The above route will only match if both request header values match.
+// If the value is an empty string, it will match any value if the key is set.
+func (r *Route) Headers(pairs ...string) *Route {
+ if r.err == nil {
+ var headers map[string]string
+ headers, r.err = mapFromPairsToString(pairs...)
+ return r.addMatcher(headerMatcher(headers))
+ }
+ return r
+}
+
+// headerRegexMatcher matches the request against the route given a regex for the header
+type headerRegexMatcher map[string]*regexp.Regexp
+
+func (m headerRegexMatcher) Match(r *http.Request, match *RouteMatch) bool {
+ return matchMapWithRegex(m, r.Header, true)
+}
+
+// HeadersRegexp accepts a sequence of key/value pairs, where the value has regex
+// support. For example:
+//
+// r := mux.NewRouter().NewRoute()
+// r.HeadersRegexp("Content-Type", "application/(text|json)",
+// "X-Requested-With", "XMLHttpRequest")
+//
+// The above route will only match if both the request header matches both regular expressions.
+// If the value is an empty string, it will match any value if the key is set.
+// Use the start and end of string anchors (^ and $) to match an exact value.
+func (r *Route) HeadersRegexp(pairs ...string) *Route {
+ if r.err == nil {
+ var headers map[string]*regexp.Regexp
+ headers, r.err = mapFromPairsToRegex(pairs...)
+ return r.addMatcher(headerRegexMatcher(headers))
+ }
+ return r
+}
+
+// Host -----------------------------------------------------------------------
+
+// Host adds a matcher for the URL host.
+// It accepts a template with zero or more URL variables enclosed by {}.
+// Variables can define an optional regexp pattern to be matched:
+//
+// - {name} matches anything until the next dot.
+//
+// - {name:pattern} matches the given regexp pattern.
+//
+// For example:
+//
+// r := mux.NewRouter().NewRoute()
+// r.Host("www.example.com")
+// r.Host("{subdomain}.domain.com")
+// r.Host("{subdomain:[a-z]+}.domain.com")
+//
+// Variable names must be unique in a given route. They can be retrieved
+// calling mux.Vars(request).
+func (r *Route) Host(tpl string) *Route {
+ r.err = r.addRegexpMatcher(tpl, regexpTypeHost)
+ return r
+}
+
+// MatcherFunc ----------------------------------------------------------------
+
+// MatcherFunc is the function signature used by custom matchers.
+type MatcherFunc func(*http.Request, *RouteMatch) bool
+
+// Match returns the match for a given request.
+func (m MatcherFunc) Match(r *http.Request, match *RouteMatch) bool {
+ return m(r, match)
+}
+
+// MatcherFunc adds a custom function to be used as request matcher.
+func (r *Route) MatcherFunc(f MatcherFunc) *Route {
+ return r.addMatcher(f)
+}
+
+// Methods --------------------------------------------------------------------
+
+// methodMatcher matches the request against HTTP methods.
+type methodMatcher []string
+
+func (m methodMatcher) Match(r *http.Request, match *RouteMatch) bool {
+ return matchInArray(m, r.Method)
+}
+
+// Methods adds a matcher for HTTP methods.
+// It accepts a sequence of one or more methods to be matched, e.g.:
+// "GET", "POST", "PUT".
+func (r *Route) Methods(methods ...string) *Route {
+ for k, v := range methods {
+ methods[k] = strings.ToUpper(v)
+ }
+ return r.addMatcher(methodMatcher(methods))
+}
+
+// Path -----------------------------------------------------------------------
+
+// Path adds a matcher for the URL path.
+// It accepts a template with zero or more URL variables enclosed by {}. The
+// template must start with a "/".
+// Variables can define an optional regexp pattern to be matched:
+//
+// - {name} matches anything until the next slash.
+//
+// - {name:pattern} matches the given regexp pattern.
+//
+// For example:
+//
+// r := mux.NewRouter().NewRoute()
+// r.Path("/products/").Handler(ProductsHandler)
+// r.Path("/products/{key}").Handler(ProductsHandler)
+// r.Path("/articles/{category}/{id:[0-9]+}").
+// Handler(ArticleHandler)
+//
+// Variable names must be unique in a given route. They can be retrieved
+// calling mux.Vars(request).
+func (r *Route) Path(tpl string) *Route {
+ r.err = r.addRegexpMatcher(tpl, regexpTypePath)
+ return r
+}
+
+// PathPrefix -----------------------------------------------------------------
+
+// PathPrefix adds a matcher for the URL path prefix. This matches if the given
+// template is a prefix of the full URL path. See Route.Path() for details on
+// the tpl argument.
+//
+// Note that it does not treat slashes specially ("/foobar/" will be matched by
+// the prefix "/foo") so you may want to use a trailing slash here.
+//
+// Also note that the setting of Router.StrictSlash() has no effect on routes
+// with a PathPrefix matcher.
+func (r *Route) PathPrefix(tpl string) *Route {
+ r.err = r.addRegexpMatcher(tpl, regexpTypePrefix)
+ return r
+}
+
+// Query ----------------------------------------------------------------------
+
+// Queries adds a matcher for URL query values.
+// It accepts a sequence of key/value pairs. Values may define variables.
+// For example:
+//
+// r := mux.NewRouter().NewRoute()
+// r.Queries("foo", "bar", "id", "{id:[0-9]+}")
+//
+// The above route will only match if the URL contains the defined queries
+// values, e.g.: ?foo=bar&id=42.
+//
+// If the value is an empty string, it will match any value if the key is set.
+//
+// Variables can define an optional regexp pattern to be matched:
+//
+// - {name} matches anything until the next slash.
+//
+// - {name:pattern} matches the given regexp pattern.
+func (r *Route) Queries(pairs ...string) *Route {
+ length := len(pairs)
+ if length%2 != 0 {
+ r.err = fmt.Errorf(
+ "mux: number of parameters must be multiple of 2, got %v", pairs)
+ return nil
+ }
+ for i := 0; i < length; i += 2 {
+ if r.err = r.addRegexpMatcher(pairs[i]+"="+pairs[i+1], regexpTypeQuery); r.err != nil {
+ return r
+ }
+ }
+
+ return r
+}
+
+// Schemes --------------------------------------------------------------------
+
+// schemeMatcher matches the request against URL schemes.
+type schemeMatcher []string
+
+func (m schemeMatcher) Match(r *http.Request, match *RouteMatch) bool {
+ scheme := r.URL.Scheme
+ // https://golang.org/pkg/net/http/#Request
+ // "For [most] server requests, fields other than Path and RawQuery will be
+ // empty."
+ // Since we're an http muxer, the scheme is either going to be http or https
+ // though, so we can just set it based on the tls termination state.
+ if scheme == "" {
+ if r.TLS == nil {
+ scheme = "http"
+ } else {
+ scheme = "https"
+ }
+ }
+ return matchInArray(m, scheme)
+}
+
+// Schemes adds a matcher for URL schemes.
+// It accepts a sequence of schemes to be matched, e.g.: "http", "https".
+// If the request's URL has a scheme set, it will be matched against.
+// Generally, the URL scheme will only be set if a previous handler set it,
+// such as the ProxyHeaders handler from gorilla/handlers.
+// If unset, the scheme will be determined based on the request's TLS
+// termination state.
+// The first argument to Schemes will be used when constructing a route URL.
+func (r *Route) Schemes(schemes ...string) *Route {
+ for k, v := range schemes {
+ schemes[k] = strings.ToLower(v)
+ }
+ if len(schemes) > 0 {
+ r.buildScheme = schemes[0]
+ }
+ return r.addMatcher(schemeMatcher(schemes))
+}
+
+// BuildVarsFunc --------------------------------------------------------------
+
+// BuildVarsFunc is the function signature used by custom build variable
+// functions (which can modify route variables before a route's URL is built).
+type BuildVarsFunc func(map[string]string) map[string]string
+
+// BuildVarsFunc adds a custom function to be used to modify build variables
+// before a route's URL is built.
+func (r *Route) BuildVarsFunc(f BuildVarsFunc) *Route {
+ if r.buildVarsFunc != nil {
+ // compose the old and new functions
+ old := r.buildVarsFunc
+ r.buildVarsFunc = func(m map[string]string) map[string]string {
+ return f(old(m))
+ }
+ } else {
+ r.buildVarsFunc = f
+ }
+ return r
+}
+
+// Subrouter ------------------------------------------------------------------
+
+// Subrouter creates a subrouter for the route.
+//
+// It will test the inner routes only if the parent route matched. For example:
+//
+// r := mux.NewRouter().NewRoute()
+// s := r.Host("www.example.com").Subrouter()
+// s.HandleFunc("/products/", ProductsHandler)
+// s.HandleFunc("/products/{key}", ProductHandler)
+// s.HandleFunc("/articles/{category}/{id:[0-9]+}"), ArticleHandler)
+//
+// Here, the routes registered in the subrouter won't be tested if the host
+// doesn't match.
+func (r *Route) Subrouter() *Router {
+ // initialize a subrouter with a copy of the parent route's configuration
+ router := &Router{routeConf: copyRouteConf(r.routeConf), namedRoutes: r.namedRoutes}
+ r.addMatcher(router)
+ return router
+}
+
+// ----------------------------------------------------------------------------
+// URL building
+// ----------------------------------------------------------------------------
+
+// URL builds a URL for the route.
+//
+// It accepts a sequence of key/value pairs for the route variables. For
+// example, given this route:
+//
+// r := mux.NewRouter()
+// r.HandleFunc("/articles/{category}/{id:[0-9]+}", ArticleHandler).
+// Name("article")
+//
+// ...a URL for it can be built using:
+//
+// url, err := r.Get("article").URL("category", "technology", "id", "42")
+//
+// ...which will return an url.URL with the following path:
+//
+// "/articles/technology/42"
+//
+// This also works for host variables:
+//
+// r := mux.NewRouter()
+// r.HandleFunc("/articles/{category}/{id:[0-9]+}", ArticleHandler).
+// Host("{subdomain}.domain.com").
+// Name("article")
+//
+// // url.String() will be "http://news.domain.com/articles/technology/42"
+// url, err := r.Get("article").URL("subdomain", "news",
+// "category", "technology",
+// "id", "42")
+//
+// The scheme of the resulting url will be the first argument that was passed to Schemes:
+//
+// // url.String() will be "https://example.com"
+// r := mux.NewRouter().NewRoute()
+// url, err := r.Host("example.com")
+// .Schemes("https", "http").URL()
+//
+// All variables defined in the route are required, and their values must
+// conform to the corresponding patterns.
+func (r *Route) URL(pairs ...string) (*url.URL, error) {
+ if r.err != nil {
+ return nil, r.err
+ }
+ values, err := r.prepareVars(pairs...)
+ if err != nil {
+ return nil, err
+ }
+ var scheme, host, path string
+ queries := make([]string, 0, len(r.regexp.queries))
+ if r.regexp.host != nil {
+ if host, err = r.regexp.host.url(values); err != nil {
+ return nil, err
+ }
+ scheme = "http"
+ if r.buildScheme != "" {
+ scheme = r.buildScheme
+ }
+ }
+ if r.regexp.path != nil {
+ if path, err = r.regexp.path.url(values); err != nil {
+ return nil, err
+ }
+ }
+ for _, q := range r.regexp.queries {
+ var query string
+ if query, err = q.url(values); err != nil {
+ return nil, err
+ }
+ queries = append(queries, query)
+ }
+ return &url.URL{
+ Scheme: scheme,
+ Host: host,
+ Path: path,
+ RawQuery: strings.Join(queries, "&"),
+ }, nil
+}
+
+// URLHost builds the host part of the URL for a route. See Route.URL().
+//
+// The route must have a host defined.
+func (r *Route) URLHost(pairs ...string) (*url.URL, error) {
+ if r.err != nil {
+ return nil, r.err
+ }
+ if r.regexp.host == nil {
+ return nil, errors.New("mux: route doesn't have a host")
+ }
+ values, err := r.prepareVars(pairs...)
+ if err != nil {
+ return nil, err
+ }
+ host, err := r.regexp.host.url(values)
+ if err != nil {
+ return nil, err
+ }
+ u := &url.URL{
+ Scheme: "http",
+ Host: host,
+ }
+ if r.buildScheme != "" {
+ u.Scheme = r.buildScheme
+ }
+ return u, nil
+}
+
+// URLPath builds the path part of the URL for a route. See Route.URL().
+//
+// The route must have a path defined.
+func (r *Route) URLPath(pairs ...string) (*url.URL, error) {
+ if r.err != nil {
+ return nil, r.err
+ }
+ if r.regexp.path == nil {
+ return nil, errors.New("mux: route doesn't have a path")
+ }
+ values, err := r.prepareVars(pairs...)
+ if err != nil {
+ return nil, err
+ }
+ path, err := r.regexp.path.url(values)
+ if err != nil {
+ return nil, err
+ }
+ return &url.URL{
+ Path: path,
+ }, nil
+}
+
+// GetPathTemplate returns the template used to build the
+// route match.
+// This is useful for building simple REST API documentation and for instrumentation
+// against third-party services.
+// An error will be returned if the route does not define a path.
+func (r *Route) GetPathTemplate() (string, error) {
+ if r.err != nil {
+ return "", r.err
+ }
+ if r.regexp.path == nil {
+ return "", errors.New("mux: route doesn't have a path")
+ }
+ return r.regexp.path.template, nil
+}
+
+// GetPathRegexp returns the expanded regular expression used to match route path.
+// This is useful for building simple REST API documentation and for instrumentation
+// against third-party services.
+// An error will be returned if the route does not define a path.
+func (r *Route) GetPathRegexp() (string, error) {
+ if r.err != nil {
+ return "", r.err
+ }
+ if r.regexp.path == nil {
+ return "", errors.New("mux: route does not have a path")
+ }
+ return r.regexp.path.regexp.String(), nil
+}
+
+// GetQueriesRegexp returns the expanded regular expressions used to match the
+// route queries.
+// This is useful for building simple REST API documentation and for instrumentation
+// against third-party services.
+// An error will be returned if the route does not have queries.
+func (r *Route) GetQueriesRegexp() ([]string, error) {
+ if r.err != nil {
+ return nil, r.err
+ }
+ if r.regexp.queries == nil {
+ return nil, errors.New("mux: route doesn't have queries")
+ }
+ queries := make([]string, 0, len(r.regexp.queries))
+ for _, query := range r.regexp.queries {
+ queries = append(queries, query.regexp.String())
+ }
+ return queries, nil
+}
+
+// GetQueriesTemplates returns the templates used to build the
+// query matching.
+// This is useful for building simple REST API documentation and for instrumentation
+// against third-party services.
+// An error will be returned if the route does not define queries.
+func (r *Route) GetQueriesTemplates() ([]string, error) {
+ if r.err != nil {
+ return nil, r.err
+ }
+ if r.regexp.queries == nil {
+ return nil, errors.New("mux: route doesn't have queries")
+ }
+ queries := make([]string, 0, len(r.regexp.queries))
+ for _, query := range r.regexp.queries {
+ queries = append(queries, query.template)
+ }
+ return queries, nil
+}
+
+// GetMethods returns the methods the route matches against
+// This is useful for building simple REST API documentation and for instrumentation
+// against third-party services.
+// An error will be returned if route does not have methods.
+func (r *Route) GetMethods() ([]string, error) {
+ if r.err != nil {
+ return nil, r.err
+ }
+ for _, m := range r.matchers {
+ if methods, ok := m.(methodMatcher); ok {
+ return []string(methods), nil
+ }
+ }
+ return nil, errors.New("mux: route doesn't have methods")
+}
+
+// GetHostTemplate returns the template used to build the
+// route match.
+// This is useful for building simple REST API documentation and for instrumentation
+// against third-party services.
+// An error will be returned if the route does not define a host.
+func (r *Route) GetHostTemplate() (string, error) {
+ if r.err != nil {
+ return "", r.err
+ }
+ if r.regexp.host == nil {
+ return "", errors.New("mux: route doesn't have a host")
+ }
+ return r.regexp.host.template, nil
+}
+
+// GetVarNames returns the names of all variables added by regexp matchers
+// These can be used to know which route variables should be passed into r.URL()
+func (r *Route) GetVarNames() ([]string, error) {
+ if r.err != nil {
+ return nil, r.err
+ }
+ var varNames []string
+ if r.regexp.host != nil {
+ varNames = append(varNames, r.regexp.host.varsN...)
+ }
+ if r.regexp.path != nil {
+ varNames = append(varNames, r.regexp.path.varsN...)
+ }
+ for _, regx := range r.regexp.queries {
+ varNames = append(varNames, regx.varsN...)
+ }
+ return varNames, nil
+}
+
+// prepareVars converts the route variable pairs into a map. If the route has a
+// BuildVarsFunc, it is invoked.
+func (r *Route) prepareVars(pairs ...string) (map[string]string, error) {
+ m, err := mapFromPairsToString(pairs...)
+ if err != nil {
+ return nil, err
+ }
+ return r.buildVars(m), nil
+}
+
+func (r *Route) buildVars(m map[string]string) map[string]string {
+ if r.buildVarsFunc != nil {
+ m = r.buildVarsFunc(m)
+ }
+ return m
+}
diff --git a/vendor/github.com/gorilla/mux/test_helpers.go b/vendor/github.com/gorilla/mux/test_helpers.go
@@ -0,0 +1,19 @@
+// Copyright 2012 The Gorilla Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package mux
+
+import "net/http"
+
+// SetURLVars sets the URL variables for the given request, to be accessed via
+// mux.Vars for testing route behaviour. Arguments are not modified, a shallow
+// copy is returned.
+//
+// This API should only be used for testing purposes; it provides a way to
+// inject variables into the request context. Alternatively, URL variables
+// can be set by making a route that captures the required variables,
+// starting a server and sending the request to that server.
+func SetURLVars(r *http.Request, val map[string]string) *http.Request {
+ return requestWithVars(r, val)
+}
diff --git a/vendor/github.com/lib/pq/.gitattributes b/vendor/github.com/lib/pq/.gitattributes
@@ -0,0 +1 @@
+*.sh text eol=lf
diff --git a/vendor/github.com/lib/pq/.gitignore b/vendor/github.com/lib/pq/.gitignore
@@ -0,0 +1,6 @@
+.db
+*.test
+*~
+*.swp
+.idea
+.vscode
+\ No newline at end of file
diff --git a/vendor/github.com/lib/pq/CHANGELOG.md b/vendor/github.com/lib/pq/CHANGELOG.md
@@ -0,0 +1,265 @@
+unreleased
+----------
+
+
+v1.12.3 (2026-04-03)
+--------------------
+- Send datestyle startup parameter, improving compatbility with database engines
+ that use a different default datestyle such as EnterpriseDB ([#1312]).
+
+[#1312]: https://github.com/lib/pq/pull/1312
+
+v1.12.2 (2026-04-02)
+--------------------
+
+- Treat io.ErrUnexpectedEOF as driver.ErrBadConn so database/sql discards the
+ connection. Since v1.12.0 this could result in permanently broken connections,
+ especially with CockroachDB which frequently sends partial messages ([#1299]).
+
+[#1299]: https://github.com/lib/pq/pull/1299
+
+v1.12.1 (2026-03-30)
+--------------------
+
+- Look for pgpass file in ~/.pgpass instead of ~/.postgresql/pgpass ([#1300]).
+
+- Don't clear password if directly set on pq.Config ([#1302]).
+
+[#1300]: https://github.com/lib/pq/pull/1300
+[#1302]: https://github.com/lib/pq/pull/1302
+
+v1.12.0 (2026-03-18)
+--------------------
+
+- The next release may change the default sslmode from `require` to `prefer`.
+ See [#1271] for details.
+
+- `CopyIn()` and `CopyInToSchema()` have been marked as deprecated. These are
+ simple query builders and not needed for `COPY [..] FROM STDIN` support (which
+ is *not* deprecated). ([#1279])
+
+ // Old
+ tx.Prepare(CopyIn("temp", "num", "text", "blob", "nothing"))
+
+ // Replacement
+ tx.Prepare(`copy temp (num, text, blob, nothing) from stdin`)
+
+### Features
+
+- Support protocol 3.2, and the `min_protocol_version` and
+ `max_protocol_version` DSN parameters ([#1258]).
+
+- Support `sslmode=prefer` and `sslmode=allow` ([#1270]).
+
+- Support `ssl_min_protocol_version` and `ssl_max_protocol_version` ([#1277]).
+
+- Support connection service file to load connection details ([#1285]).
+
+- Support `sslrootcert=system` and use `~/.postgresql/root.crt` as the default
+ value of sslrootcert ([#1280], [#1281]).
+
+- Add a new `pqerror` package with PostgreSQL error codes ([#1275]).
+
+ For example, to test if an error is a UNIQUE constraint violation:
+
+ if pqErr, ok := errors.AsType[*pq.Error](err); ok && pqErr.Code == pqerror.UniqueViolation {
+ log.Fatalf("email %q already exsts", email)
+ }
+
+ To make this a bit more convenient, it also adds a `pq.As()` function:
+
+ pqErr := pq.As(err, pqerror.UniqueViolation)
+ if pqErr != nil {
+ log.Fatalf("email %q already exsts", email)
+ }
+
+### Fixes
+
+- Fix SSL key permission check to allow modes stricter than 0600/0640#1265 ([#1265]).
+
+- Fix Hstore to work with binary parameters ([#1278]).
+
+- Clearer error when starting a new query while pq is still processing another
+ query ([#1272]).
+
+- Send intermediate CAs with client certificates, so they can be signed by an
+ intermediate CA ([#1267]).
+
+- Use `time.UTC` for UTC aliases such as `Etc/UTC` ([#1282]).
+
+[#1258]: https://github.com/lib/pq/pull/1258
+[#1265]: https://github.com/lib/pq/pull/1265
+[#1267]: https://github.com/lib/pq/pull/1267
+[#1270]: https://github.com/lib/pq/pull/1270
+[#1271]: https://github.com/lib/pq/pull/1271
+[#1272]: https://github.com/lib/pq/pull/1272
+[#1275]: https://github.com/lib/pq/pull/1275
+[#1277]: https://github.com/lib/pq/pull/1277
+[#1278]: https://github.com/lib/pq/pull/1278
+[#1279]: https://github.com/lib/pq/pull/1279
+[#1280]: https://github.com/lib/pq/pull/1280
+[#1281]: https://github.com/lib/pq/pull/1281
+[#1282]: https://github.com/lib/pq/pull/1282
+[#1283]: https://github.com/lib/pq/pull/1283
+[#1285]: https://github.com/lib/pq/pull/1285
+
+v1.11.2 (2026-02-10)
+--------------------
+This fixes two regressions:
+
+- Don't send startup parameters if there is no value, improving compatibility
+ with Supavisor ([#1260]).
+
+- Don't send `dbname` as a startup parameter if `database=[..]` is used in the
+ connection string. It's recommended to use dbname=, as database= is not a
+ libpq option, and only worked by accident previously. ([#1261])
+
+[#1260]: https://github.com/lib/pq/pull/1260
+[#1261]: https://github.com/lib/pq/pull/1261
+
+v1.11.1 (2026-01-29)
+--------------------
+This fixes two regressions present in the v1.11.0 release:
+
+- Fix build on 32bit systems, Windows, and Plan 9 ([#1253]).
+
+- Named []byte types and pointers to []byte (e.g. `*[]byte`, `json.RawMessage`)
+ would be treated as an array instead of bytea ([#1252]).
+
+[#1252]: https://github.com/lib/pq/pull/1252
+[#1253]: https://github.com/lib/pq/pull/1253
+
+v1.11.0 (2026-01-28)
+--------------------
+This version of pq requires Go 1.21 or newer.
+
+pq now supports only maintained PostgreSQL releases, which is PostgreSQL 14 and
+newer. Previously PostgreSQL 8.4 and newer were supported.
+
+### Features
+
+- The `pq.Error.Error()` text includes the position of the error (if reported
+ by PostgreSQL) and SQLSTATE code ([#1219], [#1224]):
+
+ pq: column "columndoesntexist" does not exist at column 8 (42703)
+ pq: syntax error at or near ")" at position 2:71 (42601)
+
+- The `pq.Error.ErrorWithDetail()` method prints a more detailed multiline
+ message, with the Detail, Hint, and error position (if any) ([#1219]):
+
+ ERROR: syntax error at or near ")" (42601)
+ CONTEXT: line 12, column 1:
+
+ 10 | name varchar,
+ 11 | version varchar,
+ 12 | );
+ ^
+
+- Add `Config`, `NewConfig()`, and `NewConnectorConfig()` to supply connection
+ details in a more structured way ([#1240]).
+
+- Support `hostaddr` and `$PGHOSTADDR` ([#1243]).
+
+- Support multiple values in `host`, `port`, and `hostaddr`, which are each
+ tried in order, or randomly if `load_balance_hosts=random` is set ([#1246]).
+
+- Support `target_session_attrs` connection parameter ([#1246]).
+
+- Support [`sslnegotiation`] to use SSL without negotiation ([#1180]).
+
+- Allow using a custom `tls.Config`, for example for encrypted keys ([#1228]).
+
+- Add `PQGO_DEBUG=1` print the communication with PostgreSQL to stderr, to aid
+ in debugging, testing, and bug reports ([#1223]).
+
+- Add support for NamedValueChecker interface ([#1125], [#1238]).
+
+
+### Fixes
+
+- Match HOME directory lookup logic with libpq: prefer $HOME over /etc/passwd,
+ ignore ENOTDIR errors, and use APPDATA on Windows ([#1214]).
+
+- Fix `sslmode=verify-ca` verifying the hostname anyway when connecting to a DNS
+ name (rather than IP) ([#1226]).
+
+- Correctly detect pre-protocol errors such as the server not being able to fork
+ or running out of memory ([#1248]).
+
+- Fix build with wasm ([#1184]), appengine ([#745]), and Plan 9 ([#1133]).
+
+- Deprecate and type alias `pq.NullTime` to `sql.NullTime` ([#1211]).
+
+- Enforce integer limits of the Postgres wire protocol ([#1161]).
+
+- Accept the `passfile` connection parameter to override `PGPASSFILE` ([#1129]).
+
+- Fix connecting to socket on Windows systems ([#1179]).
+
+- Don't perform a permission check on the .pgpass file on Windows ([#595]).
+
+- Warn about incorrect .pgpass permissions ([#595]).
+
+- Don't set extra_float_digits ([#1212]).
+
+- Decode bpchar into a string ([#949]).
+
+- Fix panic in Ping() by not requiring CommandComplete or EmptyQueryResponse in
+ simpleQuery() ([#1234])
+
+- Recognize bit/varbit ([#743]) and float types ([#1166]) in ColumnTypeScanType().
+
+- Accept `PGGSSLIB` and `PGKRBSRVNAME` environment variables ([#1143]).
+
+- Handle ErrorResponse in readReadyForQuery and return proper error ([#1136]).
+
+- Detect COPY even if the query starts with whitespace or comments ([#1198]).
+
+- CopyIn() and CopyInSchema() now work if the list of columns is empty, in which
+ case it will copy all columns ([#1239]).
+
+- Treat nil []byte in query parameters as nil/NULL rather than `""` ([#838]).
+
+- Accept multiple authentication methods before checking AuthOk, which improves
+ compatibility with PgPool-II ([#1188]).
+
+[`sslnegotiation`]: https://www.postgresql.org/docs/current/libpq-connect.html#LIBPQ-CONNECT-SSLNEGOTIATION
+[#595]: https://github.com/lib/pq/pull/595
+[#745]: https://github.com/lib/pq/pull/745
+[#743]: https://github.com/lib/pq/pull/743
+[#838]: https://github.com/lib/pq/pull/838
+[#949]: https://github.com/lib/pq/pull/949
+[#1125]: https://github.com/lib/pq/pull/1125
+[#1129]: https://github.com/lib/pq/pull/1129
+[#1133]: https://github.com/lib/pq/pull/1133
+[#1136]: https://github.com/lib/pq/pull/1136
+[#1143]: https://github.com/lib/pq/pull/1143
+[#1161]: https://github.com/lib/pq/pull/1161
+[#1166]: https://github.com/lib/pq/pull/1166
+[#1179]: https://github.com/lib/pq/pull/1179
+[#1180]: https://github.com/lib/pq/pull/1180
+[#1184]: https://github.com/lib/pq/pull/1184
+[#1188]: https://github.com/lib/pq/pull/1188
+[#1198]: https://github.com/lib/pq/pull/1198
+[#1211]: https://github.com/lib/pq/pull/1211
+[#1212]: https://github.com/lib/pq/pull/1212
+[#1214]: https://github.com/lib/pq/pull/1214
+[#1219]: https://github.com/lib/pq/pull/1219
+[#1223]: https://github.com/lib/pq/pull/1223
+[#1224]: https://github.com/lib/pq/pull/1224
+[#1226]: https://github.com/lib/pq/pull/1226
+[#1228]: https://github.com/lib/pq/pull/1228
+[#1234]: https://github.com/lib/pq/pull/1234
+[#1238]: https://github.com/lib/pq/pull/1238
+[#1239]: https://github.com/lib/pq/pull/1239
+[#1240]: https://github.com/lib/pq/pull/1240
+[#1243]: https://github.com/lib/pq/pull/1243
+[#1246]: https://github.com/lib/pq/pull/1246
+[#1248]: https://github.com/lib/pq/pull/1248
+
+
+v1.10.9 (2023-04-26)
+--------------------
+- Fixes backwards incompat bug with 1.13.
+
+- Fixes pgpass issue
diff --git a/vendor/github.com/lib/pq/LICENSE b/vendor/github.com/lib/pq/LICENSE
@@ -0,0 +1,21 @@
+MIT License
+
+Copyright (c) 2011-2013, 'pq' Contributors. Portions Copyright (c) 2011 Blake Mizerany
+
+Permission is hereby granted, free of charge, to any person obtaining a copy
+of this software and associated documentation files (the "Software"), to deal
+in the Software without restriction, including without limitation the rights
+to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
+copies of the Software, and to permit persons to whom the Software is
+furnished to do so, subject to the following conditions:
+
+The above copyright notice and this permission notice shall be included in all
+copies or substantial portions of the Software.
+
+THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
+IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
+FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
+AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
+LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
+OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE
+SOFTWARE.
diff --git a/vendor/github.com/lib/pq/README.md b/vendor/github.com/lib/pq/README.md
@@ -0,0 +1,312 @@
+pq is a Go PostgreSQL driver for database/sql.
+
+All [maintained versions of PostgreSQL] are supported. Older versions may work,
+but this is not tested. [API docs].
+
+[maintained versions of PostgreSQL]: https://www.postgresql.org/support/versioning
+[API docs]: https://pkg.go.dev/github.com/lib/pq
+
+Connecting
+----------
+Use the `postgres` driver name in the `sql.Open()` call:
+
+```go
+package main
+
+import (
+ "database/sql"
+ "log"
+
+ _ "github.com/lib/pq" // To register the driver.
+)
+
+func main() {
+ // Or as URL: postgresql://localhost/pqgo
+ db, err := sql.Open("postgres", "host=localhost dbname=pqgo")
+ if err != nil {
+ log.Fatal(err)
+ }
+ defer db.Close()
+
+ // db.Open() only creates a connection pool, and doesn't actually establish
+ // a connection. To ensure the connection works you need to do *something*
+ // with a connection.
+ err = db.Ping()
+ if err != nil {
+ log.Fatal(err)
+ }
+}
+```
+
+You can also use the `pq.Config` struct:
+
+```go
+cfg := pq.Config{
+ Host: "localhost",
+ Port: 5432,
+ User: "pqgo",
+}
+// Or: create a new Config from the defaults, environment, and DSN.
+// cfg, err := pq.NewConfig("host=postgres dbname=pqgo")
+// if err != nil {
+// log.Fatal(err)
+// }
+
+c, err := pq.NewConnectorConfig(cfg)
+if err != nil {
+ log.Fatal(err)
+}
+
+// Create connection pool.
+db := sql.OpenDB(c)
+defer db.Close()
+
+// Make sure it works.
+err = db.Ping()
+if err != nil {
+ log.Fatal(err)
+}
+```
+
+The DSN is identical to PostgreSQL's libpq; most parameters are supported and
+should behave identical. Both key=value and postgres:// URL-style connection
+strings are supported. See the doc comments on the [Config struct] for the full
+list and documentation.
+
+The most notable difference is that you can use any [run-time parameter] such as
+`search_path` or `work_mem` in the connection string. This is different from
+libpq, which uses the `options` parameter for this (which also works in pq).
+
+For example:
+
+ sql.Open("postgres", "dbname=pqgo work_mem=100kB search_path=xyz")
+
+The libpq way (which also works in pq) is to use `options='-c k=v'` like so:
+
+ sql.Open("postgres", "dbname=pqgo options='-c work_mem=100kB -c search_path=xyz'")
+
+[Config struct]: https://pkg.go.dev/github.com/lib/pq#Config
+[run-time parameter]: http://www.postgresql.org/docs/current/static/runtime-config.html
+
+Errors
+------
+Errors from PostgreSQL are returned as [pq.Error]; [pq.As] can be used to
+convert an error to `pq.Error`:
+
+```go
+pqErr := pq.As(err, pqerror.UniqueViolation)
+if pqErr != nil {
+ return fmt.Errorf("email %q already exsts", email)
+}
+```
+
+the Error() string contains the error message and code:
+
+ pq: duplicate key value violates unique constraint "users_lower_idx" (23505)
+
+The ErrorWithDetail() string also contains the DETAIL and CONTEXT fields, if
+present. For example for the above error this helpfully contains the duplicate
+value:
+
+ ERROR: duplicate key value violates unique constraint "users_lower_idx" (23505)
+ DETAIL: Key (lower(email))=(a@example.com) already exists.
+
+Or for an invalid syntax error like this:
+
+ pq: invalid input syntax for type json (22P02)
+
+It contains the context where this error occurred:
+
+ ERROR: invalid input syntax for type json (22P02)
+ DETAIL: Token "asd" is invalid.
+ CONTEXT: line 5, column 8:
+
+ 3 | 'def',
+ 4 | 123,
+ 5 | 'foo', 'asd'::jsonb
+ ^
+
+[pq.Error]: https://pkg.go.dev/github.com/lib/pq#Error
+[pq.As]: https://pkg.go.dev/github.com/lib/pq#As
+
+PostgreSQL features
+-------------------
+
+### Authentication
+pq supports PASSWORD, MD5, and SCRAM-SHA256 authentication out of the box. If
+you need GSS/Kerberos authentication you'll need to import the `auth/kerberos`
+module: package:
+
+ import "github.com/lib/pq/auth/kerberos"
+
+ func init() {
+ pq.RegisterGSSProvider(func() (pq.Gss, error) { return kerberos.NewGSS() })
+ }
+
+This is in a separate module so that users who don't need Kerberos (i.e. most
+users) don't have to add unnecessary dependencies.
+
+Reading a [password file] (pgpass) is also supported.
+
+[password file]: http://www.postgresql.org/docs/current/static/libpq-pgpass.html
+
+### Bulk imports with `COPY [..] FROM STDIN`
+You can perform bulk imports by preparing a `COPY [..] FROM STDIN` statement
+inside a transaction. The returned `sql.Stmt` can then be repeatedly executed to
+copy data. After all data has been processed you should call Exec() once with no
+arguments to flush all buffered data.
+
+[Further documentation][copy-doc] and [example][copy-ex].
+
+[copy-doc]: https://pkg.go.dev/github.com/lib/pq#hdr-Bulk_imports
+[copy-ex]: https://pkg.go.dev/github.com/lib/pq#example-package-CopyFromStdin
+
+### NOTICE errors
+PostgreSQL has "NOTICE" errors for informational messages. For example from the
+psql CLI:
+
+ pqgo=# drop table if exists doesnotexist;
+ NOTICE: table "doesnotexist" does not exist, skipping
+ DROP TABLE
+
+These errors are not returned because they're not really errors but, well,
+notices.
+
+You can register a callback for these notices with [ConnectorWithNoticeHandler]
+
+[ConnectorWithNoticeHandler]: https://pkg.go.dev/github.com/lib/pq#ConnectorWithNoticeHandler
+
+### Using `LISTEN`/`NOTIFY`
+With [pq.Listener] notifications are send on a channel. For example:
+
+```go
+l := pq.NewListener("dbname=pqgo", time.Second, time.Minute, nil)
+defer l.Close()
+
+err := l.Listen("coconut")
+if err != nil {
+ log.Fatal(err)
+}
+
+for {
+ n := <-l.Notify:
+ if n == nil {
+ fmt.Println("nil notify: closing Listener")
+ return
+ }
+ fmt.Printf("notification on %q with data %q\n", n.Channel, n.Extra)
+}
+```
+
+And you'll get a notification for every `notify coconut`.
+
+See the API docs for a more complete example.
+
+[pq.Listener]: https://pkg.go.dev/github.com/lib/pq#Listener
+
+
+Caveats
+-------
+### LastInsertId
+sql.Result.LastInsertId() is not supported, because the PostgreSQL protocol does
+not have this facility. Use `insert [..] returning [cols]` instead:
+
+ db.QueryRow(`insert into tbl [..] returning id_col`).Scan(..)
+ // Or multiple rows:
+ db.Query(`insert into tbl (row1), (row2) returning id_col`)
+
+This will also work in SQLite and MariaDB with the same syntax. MS-SQL and
+Oracle have a similar facility (with a different syntax).
+
+### timestamps
+For timestamps with a timezone (`timestamptz`/`timestamp with time zone`), pq
+uses the timezone configured in the server, as libpq. You can change this with
+`timestamp=[..]` in the connection string. It's generally recommended to use
+UTC.
+
+For timestamps without a timezone (`timestamp`/`timestamp without time zone`),
+pq always uses `time.FixedZone("", 0)` as the timezone; the timestamp parameter
+has no effect here. This is intentionally not equal to time.UTC, as it's not a
+UTC time: it's a time without a timezone. Go's time package does not really
+support this concept, so this is the best we can do This will print `+0000`
+twice (e.g. `2026-03-15 17:45:47 +0000 +0000`; having a clearer name would have
+been better, but is not compatible change). See [this comment][ts] for some
+options on how to deal with this.
+
+Also see the examples for [timestamptz] and [timestamp]
+
+[ts]: https://github.com/lib/pq/issues/329#issuecomment-4025733506
+[timestamptz]: https://pkg.go.dev/github.com/lib/pq#example-package-TimestampWithTimezone
+[timestamp]: https://pkg.go.dev/github.com/lib/pq#example-package-TimestampWithoutTimezone
+
+### bytea with copy
+All `[]byte` parameters are encoded as `bytea` when using `copy [..] from
+stdin`, which may result in errors for e.g. `jsonb` columns. The solution is to
+use a string instead of []byte. See #1023
+
+Development
+-----------
+### Running tests
+Tests need to be run against a PostgreSQL database; you can use Docker compose
+to start one:
+
+ docker compose up -d
+
+This starts the latest PostgreSQL; use `docker compose up -d pg«v»` to start a
+different version.
+
+In addition, your `/etc/hosts` needs an entry:
+
+ 127.0.0.1 postgres postgres-invalid
+
+Or you can use any other PostgreSQL instance; see
+`testdata/postgres/docker-entrypoint-initdb.d` for the required setup. You can use
+the standard `PG*` environment variables to control the connection details; it
+uses the following defaults:
+
+ PGHOST=localhost
+ PGDATABASE=pqgo
+ PGUSER=pqgo
+ PGSSLMODE=disable
+ PGCONNECT_TIMEOUT=20
+
+`PQTEST_BINARY_PARAMETERS` can be used to add `binary_parameters=yes` to all
+connection strings:
+
+ PQTEST_BINARY_PARAMETERS=1 go test
+
+Tests can be run against pgbouncer with:
+
+ docker compose up -d pgbouncer pg18
+ PGPORT=6432 go test ./...
+
+and pgpool with:
+
+ docker compose up -d pgpool pg18
+ PGPORT=7432 go test ./...
+
+### Protocol debug output
+You can use PQGO_DEBUG=1 to make the driver print the communication with
+PostgreSQL to stderr; this works anywhere (test or applications) and can be
+useful to debug protocol problems.
+
+For example:
+
+ % PQGO_DEBUG=1 go test -run TestSimpleQuery
+ CLIENT → Startup 69 "\x00\x03\x00\x00database\x00pqgo\x00user [..]"
+ SERVER ← (R) AuthRequest 4 "\x00\x00\x00\x00"
+ SERVER ← (S) ParamStatus 19 "in_hot_standby\x00off\x00"
+ [..]
+ SERVER ← (Z) ReadyForQuery 1 "I"
+ START conn.query
+ START conn.simpleQuery
+ CLIENT → (Q) Query 9 "select 1\x00"
+ SERVER ← (T) RowDescription 29 "\x00\x01?column?\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x17\x00\x04\xff\xff\xff\xff\x00\x00"
+ SERVER ← (D) DataRow 7 "\x00\x01\x00\x00\x00\x011"
+ END conn.simpleQuery
+ END conn.query
+ SERVER ← (C) CommandComplete 9 "SELECT 1\x00"
+ SERVER ← (Z) ReadyForQuery 1 "I"
+ CLIENT → (X) Terminate 0 ""
+ PASS
+ ok github.com/lib/pq 0.010s
diff --git a/vendor/github.com/lib/pq/array.go b/vendor/github.com/lib/pq/array.go
@@ -0,0 +1,903 @@
+package pq
+
+import (
+ "bytes"
+ "database/sql"
+ "database/sql/driver"
+ "encoding/hex"
+ "fmt"
+ "reflect"
+ "strconv"
+ "strings"
+)
+
+var typeByteSlice = reflect.TypeOf([]byte{})
+var typeDriverValuer = reflect.TypeOf((*driver.Valuer)(nil)).Elem()
+var typeSQLScanner = reflect.TypeOf((*sql.Scanner)(nil)).Elem()
+
+// Array returns the optimal driver.Valuer and sql.Scanner for an array or
+// slice of any dimension.
+//
+// For example:
+//
+// db.Query(`SELECT * FROM t WHERE id = ANY($1)`, pq.Array([]int{235, 401}))
+//
+// var x []sql.NullInt64
+// db.QueryRow(`SELECT ARRAY[235, 401]`).Scan(pq.Array(&x))
+//
+// Scanning multi-dimensional arrays is not supported. Arrays where the lower
+// bound is not one (such as `[0:0]={1}') are not supported.
+func Array(a any) interface {
+ driver.Valuer
+ sql.Scanner
+} {
+ switch a := a.(type) {
+ case []bool:
+ return (*BoolArray)(&a)
+ case []float64:
+ return (*Float64Array)(&a)
+ case []float32:
+ return (*Float32Array)(&a)
+ case []int64:
+ return (*Int64Array)(&a)
+ case []int32:
+ return (*Int32Array)(&a)
+ case []string:
+ return (*StringArray)(&a)
+ case [][]byte:
+ return (*ByteaArray)(&a)
+
+ case *[]bool:
+ return (*BoolArray)(a)
+ case *[]float64:
+ return (*Float64Array)(a)
+ case *[]float32:
+ return (*Float32Array)(a)
+ case *[]int64:
+ return (*Int64Array)(a)
+ case *[]int32:
+ return (*Int32Array)(a)
+ case *[]string:
+ return (*StringArray)(a)
+ case *[][]byte:
+ return (*ByteaArray)(a)
+ }
+
+ return GenericArray{a}
+}
+
+// ArrayDelimiter may be optionally implemented by driver.Valuer or sql.Scanner
+// to override the array delimiter used by GenericArray.
+type ArrayDelimiter interface {
+ // ArrayDelimiter returns the delimiter character(s) for this element's type.
+ ArrayDelimiter() string
+}
+
+// BoolArray represents a one-dimensional array of the PostgreSQL boolean type.
+type BoolArray []bool
+
+// Scan implements the sql.Scanner interface.
+func (a *BoolArray) Scan(src any) error {
+ switch src := src.(type) {
+ case []byte:
+ return a.scanBytes(src)
+ case string:
+ return a.scanBytes([]byte(src))
+ case nil:
+ *a = nil
+ return nil
+ }
+
+ return fmt.Errorf("pq: cannot convert %T to BoolArray", src)
+}
+
+func (a *BoolArray) scanBytes(src []byte) error {
+ elems, err := scanLinearArray(src, []byte{','}, "BoolArray")
+ if err != nil {
+ return err
+ }
+ if *a != nil && len(elems) == 0 {
+ *a = (*a)[:0]
+ } else {
+ b := make(BoolArray, len(elems))
+ for i, v := range elems {
+ if len(v) != 1 {
+ return fmt.Errorf("pq: could not parse boolean array index %d: invalid boolean %q", i, v)
+ }
+ switch v[0] {
+ case 't':
+ b[i] = true
+ case 'f':
+ b[i] = false
+ default:
+ return fmt.Errorf("pq: could not parse boolean array index %d: invalid boolean %q", i, v)
+ }
+ }
+ *a = b
+ }
+ return nil
+}
+
+// Value implements the driver.Valuer interface.
+func (a BoolArray) Value() (driver.Value, error) {
+ if a == nil {
+ return nil, nil
+ }
+
+ if n := len(a); n > 0 {
+ // There will be exactly two curly brackets, N bytes of values,
+ // and N-1 bytes of delimiters.
+ b := make([]byte, 1+2*n)
+
+ for i := 0; i < n; i++ {
+ b[2*i] = ','
+ if a[i] {
+ b[1+2*i] = 't'
+ } else {
+ b[1+2*i] = 'f'
+ }
+ }
+
+ b[0] = '{'
+ b[2*n] = '}'
+
+ return string(b), nil
+ }
+
+ return "{}", nil
+}
+
+// ByteaArray represents a one-dimensional array of the PostgreSQL bytea type.
+type ByteaArray [][]byte
+
+// Scan implements the sql.Scanner interface.
+func (a *ByteaArray) Scan(src any) error {
+ switch src := src.(type) {
+ case []byte:
+ return a.scanBytes(src)
+ case string:
+ return a.scanBytes([]byte(src))
+ case nil:
+ *a = nil
+ return nil
+ }
+
+ return fmt.Errorf("pq: cannot convert %T to ByteaArray", src)
+}
+
+func (a *ByteaArray) scanBytes(src []byte) error {
+ elems, err := scanLinearArray(src, []byte{','}, "ByteaArray")
+ if err != nil {
+ return err
+ }
+ if *a != nil && len(elems) == 0 {
+ *a = (*a)[:0]
+ } else {
+ b := make(ByteaArray, len(elems))
+ for i, v := range elems {
+ b[i], err = parseBytea(v)
+ if err != nil {
+ return fmt.Errorf("could not parse bytea array index %d: %w", i, err)
+ }
+ }
+ *a = b
+ }
+ return nil
+}
+
+// Value implements the driver.Valuer interface. It uses the "hex" format which
+// is only supported on PostgreSQL 9.0 or newer.
+func (a ByteaArray) Value() (driver.Value, error) {
+ if a == nil {
+ return nil, nil
+ }
+
+ if n := len(a); n > 0 {
+ // There will be at least two curly brackets, 2*N bytes of quotes,
+ // 3*N bytes of hex formatting, and N-1 bytes of delimiters.
+ size := 1 + 6*n
+ for _, x := range a {
+ size += hex.EncodedLen(len(x))
+ }
+
+ b := make([]byte, size)
+
+ for i, s := 0, b; i < n; i++ {
+ o := copy(s, `,"\\x`)
+ o += hex.Encode(s[o:], a[i])
+ s[o] = '"'
+ s = s[o+1:]
+ }
+
+ b[0] = '{'
+ b[size-1] = '}'
+
+ return string(b), nil
+ }
+
+ return "{}", nil
+}
+
+// Float64Array represents a one-dimensional array of the PostgreSQL double
+// precision type.
+type Float64Array []float64
+
+// Scan implements the sql.Scanner interface.
+func (a *Float64Array) Scan(src any) error {
+ switch src := src.(type) {
+ case []byte:
+ return a.scanBytes(src)
+ case string:
+ return a.scanBytes([]byte(src))
+ case nil:
+ *a = nil
+ return nil
+ }
+
+ return fmt.Errorf("pq: cannot convert %T to Float64Array", src)
+}
+
+func (a *Float64Array) scanBytes(src []byte) error {
+ elems, err := scanLinearArray(src, []byte{','}, "Float64Array")
+ if err != nil {
+ return err
+ }
+ if *a != nil && len(elems) == 0 {
+ *a = (*a)[:0]
+ } else {
+ b := make(Float64Array, len(elems))
+ for i, v := range elems {
+ b[i], err = strconv.ParseFloat(string(v), 64)
+ if err != nil {
+ return fmt.Errorf("pq: parsing array element index %d: %w", i, err)
+ }
+ }
+ *a = b
+ }
+ return nil
+}
+
+// Value implements the driver.Valuer interface.
+func (a Float64Array) Value() (driver.Value, error) {
+ if a == nil {
+ return nil, nil
+ }
+
+ if n := len(a); n > 0 {
+ // There will be at least two curly brackets, N bytes of values,
+ // and N-1 bytes of delimiters.
+ b := make([]byte, 1, 1+2*n)
+ b[0] = '{'
+
+ b = strconv.AppendFloat(b, a[0], 'f', -1, 64)
+ for i := 1; i < n; i++ {
+ b = append(b, ',')
+ b = strconv.AppendFloat(b, a[i], 'f', -1, 64)
+ }
+
+ return string(append(b, '}')), nil
+ }
+
+ return "{}", nil
+}
+
+// Float32Array represents a one-dimensional array of the PostgreSQL double
+// precision type.
+type Float32Array []float32
+
+// Scan implements the sql.Scanner interface.
+func (a *Float32Array) Scan(src any) error {
+ switch src := src.(type) {
+ case []byte:
+ return a.scanBytes(src)
+ case string:
+ return a.scanBytes([]byte(src))
+ case nil:
+ *a = nil
+ return nil
+ }
+
+ return fmt.Errorf("pq: cannot convert %T to Float32Array", src)
+}
+
+func (a *Float32Array) scanBytes(src []byte) error {
+ elems, err := scanLinearArray(src, []byte{','}, "Float32Array")
+ if err != nil {
+ return err
+ }
+ if *a != nil && len(elems) == 0 {
+ *a = (*a)[:0]
+ } else {
+ b := make(Float32Array, len(elems))
+ for i, v := range elems {
+ x, err := strconv.ParseFloat(string(v), 32)
+ if err != nil {
+ return fmt.Errorf("pq: parsing array element index %d: %w", i, err)
+ }
+ b[i] = float32(x)
+ }
+ *a = b
+ }
+ return nil
+}
+
+// Value implements the driver.Valuer interface.
+func (a Float32Array) Value() (driver.Value, error) {
+ if a == nil {
+ return nil, nil
+ }
+
+ if n := len(a); n > 0 {
+ // There will be at least two curly brackets, N bytes of values,
+ // and N-1 bytes of delimiters.
+ b := make([]byte, 1, 1+2*n)
+ b[0] = '{'
+
+ b = strconv.AppendFloat(b, float64(a[0]), 'f', -1, 32)
+ for i := 1; i < n; i++ {
+ b = append(b, ',')
+ b = strconv.AppendFloat(b, float64(a[i]), 'f', -1, 32)
+ }
+
+ return string(append(b, '}')), nil
+ }
+
+ return "{}", nil
+}
+
+// GenericArray implements the driver.Valuer and sql.Scanner interfaces for
+// an array or slice of any dimension.
+type GenericArray struct{ A any }
+
+func (GenericArray) evaluateDestination(rt reflect.Type) (reflect.Type, func([]byte, reflect.Value) error, string) {
+ var assign func([]byte, reflect.Value) error
+ var del = ","
+
+ // TODO calculate the assign function for other types
+ // TODO repeat this section on the element type of arrays or slices (multidimensional)
+ {
+ if reflect.PointerTo(rt).Implements(typeSQLScanner) {
+ // dest is always addressable because it is an element of a slice.
+ assign = func(src []byte, dest reflect.Value) (err error) {
+ ss := dest.Addr().Interface().(sql.Scanner)
+ if src == nil {
+ err = ss.Scan(nil)
+ } else {
+ err = ss.Scan(src)
+ }
+ return
+ }
+ goto FoundType
+ }
+
+ assign = func([]byte, reflect.Value) error {
+ return fmt.Errorf("pq: scanning to %s is not implemented; only sql.Scanner", rt)
+ }
+ }
+
+FoundType:
+
+ if ad, ok := reflect.Zero(rt).Interface().(ArrayDelimiter); ok {
+ del = ad.ArrayDelimiter()
+ }
+
+ return rt, assign, del
+}
+
+// Scan implements the sql.Scanner interface.
+func (a GenericArray) Scan(src any) error {
+ dpv := reflect.ValueOf(a.A)
+ switch {
+ case dpv.Kind() != reflect.Pointer:
+ return fmt.Errorf("pq: destination %T is not a pointer to array or slice", a.A)
+ case dpv.IsNil():
+ return fmt.Errorf("pq: destination %T is nil", a.A)
+ }
+
+ dv := dpv.Elem()
+ switch dv.Kind() {
+ case reflect.Slice:
+ case reflect.Array:
+ default:
+ return fmt.Errorf("pq: destination %T is not a pointer to array or slice", a.A)
+ }
+
+ switch src := src.(type) {
+ case []byte:
+ return a.scanBytes(src, dv)
+ case string:
+ return a.scanBytes([]byte(src), dv)
+ case nil:
+ if dv.Kind() == reflect.Slice {
+ dv.Set(reflect.Zero(dv.Type()))
+ return nil
+ }
+ }
+
+ return fmt.Errorf("pq: cannot convert %T to %s", src, dv.Type())
+}
+
+func (a GenericArray) scanBytes(src []byte, dv reflect.Value) error {
+ dtype, assign, del := a.evaluateDestination(dv.Type().Elem())
+ dims, elems, err := parseArray(src, []byte(del))
+ if err != nil {
+ return err
+ }
+
+ // TODO allow multidimensional
+
+ if len(dims) > 1 {
+ return fmt.Errorf("pq: scanning from multidimensional ARRAY%s is not implemented",
+ strings.Replace(fmt.Sprint(dims), " ", "][", -1))
+ }
+
+ // Treat a zero-dimensional array like an array with a single dimension of zero.
+ if len(dims) == 0 {
+ dims = append(dims, 0)
+ }
+
+ for i, rt := 0, dv.Type(); i < len(dims); i, rt = i+1, rt.Elem() {
+ switch rt.Kind() {
+ case reflect.Slice:
+ case reflect.Array:
+ if rt.Len() != dims[i] {
+ return fmt.Errorf("pq: cannot convert ARRAY%s to %s",
+ strings.Replace(fmt.Sprint(dims), " ", "][", -1), dv.Type())
+ }
+ default:
+ // TODO handle multidimensional
+ }
+ }
+
+ values := reflect.MakeSlice(reflect.SliceOf(dtype), len(elems), len(elems))
+ for i, e := range elems {
+ err := assign(e, values.Index(i))
+ if err != nil {
+ return fmt.Errorf("pq: parsing array element index %d: %w", i, err)
+ }
+ }
+
+ // TODO handle multidimensional
+
+ switch dv.Kind() {
+ case reflect.Slice:
+ dv.Set(values.Slice(0, dims[0]))
+ case reflect.Array:
+ for i := 0; i < dims[0]; i++ {
+ dv.Index(i).Set(values.Index(i))
+ }
+ }
+
+ return nil
+}
+
+// Value implements the driver.Valuer interface.
+func (a GenericArray) Value() (driver.Value, error) {
+ if a.A == nil {
+ return nil, nil
+ }
+
+ rv := reflect.ValueOf(a.A)
+
+ switch rv.Kind() {
+ case reflect.Slice:
+ if rv.IsNil() {
+ return nil, nil
+ }
+ case reflect.Array:
+ default:
+ return nil, fmt.Errorf("pq: unable to convert %T to array", a.A)
+ }
+
+ if n := rv.Len(); n > 0 {
+ // There will be at least two curly brackets, N bytes of values,
+ // and N-1 bytes of delimiters.
+ b := make([]byte, 0, 1+2*n)
+
+ b, _, err := appendArray(b, rv, n)
+ return string(b), err
+ }
+
+ return "{}", nil
+}
+
+// Int64Array represents a one-dimensional array of the PostgreSQL integer types.
+type Int64Array []int64
+
+// Scan implements the sql.Scanner interface.
+func (a *Int64Array) Scan(src any) error {
+ switch src := src.(type) {
+ case []byte:
+ return a.scanBytes(src)
+ case string:
+ return a.scanBytes([]byte(src))
+ case nil:
+ *a = nil
+ return nil
+ }
+
+ return fmt.Errorf("pq: cannot convert %T to Int64Array", src)
+}
+
+func (a *Int64Array) scanBytes(src []byte) error {
+ elems, err := scanLinearArray(src, []byte{','}, "Int64Array")
+ if err != nil {
+ return err
+ }
+ if *a != nil && len(elems) == 0 {
+ *a = (*a)[:0]
+ } else {
+ b := make(Int64Array, len(elems))
+ for i, v := range elems {
+ b[i], err = strconv.ParseInt(string(v), 10, 64)
+ if err != nil {
+ return fmt.Errorf("pq: parsing array element index %d: %w", i, err)
+ }
+ }
+ *a = b
+ }
+ return nil
+}
+
+// Value implements the driver.Valuer interface.
+func (a Int64Array) Value() (driver.Value, error) {
+ if a == nil {
+ return nil, nil
+ }
+
+ if n := len(a); n > 0 {
+ // There will be at least two curly brackets, N bytes of values,
+ // and N-1 bytes of delimiters.
+ b := make([]byte, 1, 1+2*n)
+ b[0] = '{'
+
+ b = strconv.AppendInt(b, a[0], 10)
+ for i := 1; i < n; i++ {
+ b = append(b, ',')
+ b = strconv.AppendInt(b, a[i], 10)
+ }
+
+ return string(append(b, '}')), nil
+ }
+
+ return "{}", nil
+}
+
+// Int32Array represents a one-dimensional array of the PostgreSQL integer types.
+type Int32Array []int32
+
+// Scan implements the sql.Scanner interface.
+func (a *Int32Array) Scan(src any) error {
+ switch src := src.(type) {
+ case []byte:
+ return a.scanBytes(src)
+ case string:
+ return a.scanBytes([]byte(src))
+ case nil:
+ *a = nil
+ return nil
+ }
+
+ return fmt.Errorf("pq: cannot convert %T to Int32Array", src)
+}
+
+func (a *Int32Array) scanBytes(src []byte) error {
+ elems, err := scanLinearArray(src, []byte{','}, "Int32Array")
+ if err != nil {
+ return err
+ }
+ if *a != nil && len(elems) == 0 {
+ *a = (*a)[:0]
+ } else {
+ b := make(Int32Array, len(elems))
+ for i, v := range elems {
+ x, err := strconv.ParseInt(string(v), 10, 32)
+ if err != nil {
+ return fmt.Errorf("pq: parsing array element index %d: %w", i, err)
+ }
+ b[i] = int32(x)
+ }
+ *a = b
+ }
+ return nil
+}
+
+// Value implements the driver.Valuer interface.
+func (a Int32Array) Value() (driver.Value, error) {
+ if a == nil {
+ return nil, nil
+ }
+
+ if n := len(a); n > 0 {
+ // There will be at least two curly brackets, N bytes of values,
+ // and N-1 bytes of delimiters.
+ b := make([]byte, 1, 1+2*n)
+ b[0] = '{'
+
+ b = strconv.AppendInt(b, int64(a[0]), 10)
+ for i := 1; i < n; i++ {
+ b = append(b, ',')
+ b = strconv.AppendInt(b, int64(a[i]), 10)
+ }
+
+ return string(append(b, '}')), nil
+ }
+
+ return "{}", nil
+}
+
+// StringArray represents a one-dimensional array of the PostgreSQL character types.
+type StringArray []string
+
+// Scan implements the sql.Scanner interface.
+func (a *StringArray) Scan(src any) error {
+ switch src := src.(type) {
+ case []byte:
+ return a.scanBytes(src)
+ case string:
+ return a.scanBytes([]byte(src))
+ case nil:
+ *a = nil
+ return nil
+ }
+
+ return fmt.Errorf("pq: cannot convert %T to StringArray", src)
+}
+
+func (a *StringArray) scanBytes(src []byte) error {
+ elems, err := scanLinearArray(src, []byte{','}, "StringArray")
+ if err != nil {
+ return err
+ }
+ if *a != nil && len(elems) == 0 {
+ *a = (*a)[:0]
+ } else {
+ b := make(StringArray, len(elems))
+ for i, v := range elems {
+ if b[i] = string(v); v == nil {
+ return fmt.Errorf("pq: parsing array element index %d: cannot convert nil to string", i)
+ }
+ }
+ *a = b
+ }
+ return nil
+}
+
+// Value implements the driver.Valuer interface.
+func (a StringArray) Value() (driver.Value, error) {
+ if a == nil {
+ return nil, nil
+ }
+
+ if n := len(a); n > 0 {
+ // There will be at least two curly brackets, 2*N bytes of quotes,
+ // and N-1 bytes of delimiters.
+ b := make([]byte, 1, 1+3*n)
+ b[0] = '{'
+
+ b = appendArrayQuotedBytes(b, []byte(a[0]))
+ for i := 1; i < n; i++ {
+ b = append(b, ',')
+ b = appendArrayQuotedBytes(b, []byte(a[i]))
+ }
+
+ return string(append(b, '}')), nil
+ }
+
+ return "{}", nil
+}
+
+// appendArray appends rv to the buffer, returning the extended buffer and the
+// delimiter used between elements.
+//
+// Returns an error when n <= 0 or rv is not a reflect.Array or reflect.Slice.
+func appendArray(b []byte, rv reflect.Value, n int) ([]byte, string, error) {
+ var del string
+ var err error
+
+ b = append(b, '{')
+
+ if b, del, err = appendArrayElement(b, rv.Index(0)); err != nil {
+ return b, del, err
+ }
+
+ for i := 1; i < n; i++ {
+ b = append(b, del...)
+ if b, del, err = appendArrayElement(b, rv.Index(i)); err != nil {
+ return b, del, err
+ }
+ }
+
+ return append(b, '}'), del, nil
+}
+
+// appendArrayElement appends rv to the buffer, returning the extended buffer
+// and the delimiter to use before the next element.
+//
+// When rv's Kind is neither reflect.Array nor reflect.Slice, it is converted
+// using driver.DefaultParameterConverter and the resulting []byte or string
+// is double-quoted.
+//
+// See http://www.postgresql.org/docs/current/static/arrays.html#ARRAYS-IO
+func appendArrayElement(b []byte, rv reflect.Value) ([]byte, string, error) {
+ if k := rv.Kind(); k == reflect.Array || k == reflect.Slice {
+ if t := rv.Type(); t != typeByteSlice && !t.Implements(typeDriverValuer) {
+ if n := rv.Len(); n > 0 {
+ return appendArray(b, rv, n)
+ }
+
+ return b, "", nil
+ }
+ }
+
+ var del = ","
+ var err error
+ var iv = rv.Interface()
+
+ if ad, ok := iv.(ArrayDelimiter); ok {
+ del = ad.ArrayDelimiter()
+ }
+
+ if iv, err = driver.DefaultParameterConverter.ConvertValue(iv); err != nil {
+ return b, del, err
+ }
+
+ switch v := iv.(type) {
+ case nil:
+ return append(b, "NULL"...), del, nil
+ case []byte:
+ return appendArrayQuotedBytes(b, v), del, nil
+ case string:
+ return appendArrayQuotedBytes(b, []byte(v)), del, nil
+ }
+
+ b, err = appendValue(b, iv)
+ return b, del, err
+}
+
+func appendArrayQuotedBytes(b, v []byte) []byte {
+ b = append(b, '"')
+ for {
+ i := bytes.IndexAny(v, `"\`)
+ if i < 0 {
+ b = append(b, v...)
+ break
+ }
+ if i > 0 {
+ b = append(b, v[:i]...)
+ }
+ b = append(b, '\\', v[i])
+ v = v[i+1:]
+ }
+ return append(b, '"')
+}
+
+func appendValue(b []byte, v driver.Value) ([]byte, error) {
+ enc, err := encode(v, 0)
+ if err != nil {
+ return nil, err
+ }
+ return append(b, enc...), nil
+}
+
+// parseArray extracts the dimensions and elements of an array represented in
+// text format. Only representations emitted by the backend are supported.
+// Notably, whitespace around brackets and delimiters is significant, and NULL
+// is case-sensitive.
+//
+// See http://www.postgresql.org/docs/current/static/arrays.html#ARRAYS-IO
+func parseArray(src, del []byte) (dims []int, elems [][]byte, err error) {
+ var depth, i int
+
+ if len(src) < 1 || src[0] != '{' {
+ return nil, nil, fmt.Errorf("pq: unable to parse array; expected %q at offset %d", '{', 0)
+ }
+
+Open:
+ for i < len(src) {
+ switch src[i] {
+ case '{':
+ depth++
+ i++
+ case '}':
+ elems = make([][]byte, 0)
+ goto Close
+ default:
+ break Open
+ }
+ }
+ dims = make([]int, i)
+
+Element:
+ for i < len(src) {
+ switch src[i] {
+ case '{':
+ if depth == len(dims) {
+ break Element
+ }
+ depth++
+ dims[depth-1] = 0
+ i++
+ case '"':
+ var elem = []byte{}
+ var escape bool
+ for i++; i < len(src); i++ {
+ if escape {
+ elem = append(elem, src[i])
+ escape = false
+ } else {
+ switch src[i] {
+ default:
+ elem = append(elem, src[i])
+ case '\\':
+ escape = true
+ case '"':
+ elems = append(elems, elem)
+ i++
+ break Element
+ }
+ }
+ }
+ default:
+ for start := i; i < len(src); i++ {
+ if bytes.HasPrefix(src[i:], del) || src[i] == '}' {
+ elem := src[start:i]
+ if len(elem) == 0 {
+ return nil, nil, fmt.Errorf("pq: unable to parse array; unexpected %q at offset %d", src[i], i)
+ }
+ if bytes.Equal(elem, []byte("NULL")) {
+ elem = nil
+ }
+ elems = append(elems, elem)
+ break Element
+ }
+ }
+ }
+ }
+
+ for i < len(src) {
+ if bytes.HasPrefix(src[i:], del) && depth > 0 {
+ dims[depth-1]++
+ i += len(del)
+ goto Element
+ } else if src[i] == '}' && depth > 0 {
+ dims[depth-1]++
+ depth--
+ i++
+ } else {
+ return nil, nil, fmt.Errorf("pq: unable to parse array; unexpected %q at offset %d", src[i], i)
+ }
+ }
+
+Close:
+ for i < len(src) {
+ if src[i] == '}' && depth > 0 {
+ depth--
+ i++
+ } else {
+ return nil, nil, fmt.Errorf("pq: unable to parse array; unexpected %q at offset %d", src[i], i)
+ }
+ }
+ if depth > 0 {
+ err = fmt.Errorf("pq: unable to parse array; expected %q at offset %d", '}', i)
+ }
+ if err == nil {
+ for _, d := range dims {
+ if (len(elems) % d) != 0 {
+ err = fmt.Errorf("pq: multidimensional arrays must have elements with matching dimensions")
+ }
+ }
+ }
+ return
+}
+
+func scanLinearArray(src, del []byte, typ string) (elems [][]byte, err error) {
+ dims, elems, err := parseArray(src, del)
+ if err != nil {
+ return nil, err
+ }
+ if len(dims) > 1 {
+ return nil, fmt.Errorf("pq: cannot convert ARRAY%s to %s", strings.Replace(fmt.Sprint(dims), " ", "][", -1), typ)
+ }
+ return elems, err
+}
diff --git a/vendor/github.com/lib/pq/as.go b/vendor/github.com/lib/pq/as.go
@@ -0,0 +1,26 @@
+//go:build !go1.26
+
+package pq
+
+import (
+ "errors"
+ "slices"
+)
+
+// As asserts that the given error is [pq.Error] and returns it, returning nil
+// if it's not a pq.Error.
+//
+// It will return nil if the pq.Error is not one of the given error codes. If no
+// codes are given it will always return the Error.
+//
+// This is safe to call with a nil error.
+func As(err error, codes ...ErrorCode) *Error {
+ if err == nil { // Not strictly needed, but prevents alloc for nil errors.
+ return nil
+ }
+ pqErr := new(Error)
+ if errors.As(err, &pqErr) && (len(codes) == 0 || slices.Contains(codes, pqErr.Code)) {
+ return pqErr
+ }
+ return nil
+}
diff --git a/vendor/github.com/lib/pq/as_go126.go b/vendor/github.com/lib/pq/as_go126.go
@@ -0,0 +1,23 @@
+//go:build go1.26
+
+package pq
+
+import (
+ "errors"
+ "github.com/lib/pq/pqerror"
+ "slices"
+)
+
+// As asserts that the given error is [pq.Error] and returns it, returning nil
+// if it's not a pq.Error.
+//
+// It will return nil if the pq.Error is not one of the given error codes. If no
+// codes are given it will always return the Error.
+//
+// This is safe to call with a nil error.
+func As(err error, codes ...pqerror.Code) *Error {
+ if pqErr, ok := errors.AsType[*Error](err); ok && (len(codes) == 0 || slices.Contains(codes, pqErr.Code)) {
+ return pqErr
+ }
+ return nil
+}
diff --git a/vendor/github.com/lib/pq/buf.go b/vendor/github.com/lib/pq/buf.go
@@ -0,0 +1,100 @@
+package pq
+
+import (
+ "bytes"
+ "encoding/binary"
+ "errors"
+ "fmt"
+
+ "github.com/lib/pq/internal/proto"
+ "github.com/lib/pq/oid"
+)
+
+type readBuf []byte
+
+func (b *readBuf) int32() (n int) {
+ n = int(int32(binary.BigEndian.Uint32(*b)))
+ *b = (*b)[4:]
+ return
+}
+
+func (b *readBuf) oid() (n oid.Oid) {
+ n = oid.Oid(binary.BigEndian.Uint32(*b))
+ *b = (*b)[4:]
+ return
+}
+
+// N.B: this is actually an unsigned 16-bit integer, unlike int32
+func (b *readBuf) int16() (n int) {
+ n = int(binary.BigEndian.Uint16(*b))
+ *b = (*b)[2:]
+ return
+}
+
+func (b *readBuf) string() string {
+ i := bytes.IndexByte(*b, 0)
+ if i < 0 {
+ panic(errors.New("pq: invalid message format; expected string terminator"))
+ }
+ s := (*b)[:i]
+ *b = (*b)[i+1:]
+ return string(s)
+}
+
+func (b *readBuf) next(n int) (v []byte) {
+ v = (*b)[:n]
+ *b = (*b)[n:]
+ return
+}
+
+func (b *readBuf) byte() byte {
+ return b.next(1)[0]
+}
+
+type writeBuf struct {
+ buf []byte
+ pos int
+}
+
+func (b *writeBuf) int32(n int) {
+ x := make([]byte, 4)
+ binary.BigEndian.PutUint32(x, uint32(n))
+ b.buf = append(b.buf, x...)
+}
+
+func (b *writeBuf) int16(n int) {
+ x := make([]byte, 2)
+ binary.BigEndian.PutUint16(x, uint16(n))
+ b.buf = append(b.buf, x...)
+}
+
+func (b *writeBuf) string(s string) {
+ b.buf = append(append(b.buf, s...), '\000')
+}
+
+func (b *writeBuf) byte(c proto.RequestCode) {
+ b.buf = append(b.buf, byte(c))
+}
+
+func (b *writeBuf) bytes(v []byte) {
+ b.buf = append(b.buf, v...)
+}
+
+func (b *writeBuf) wrap() []byte {
+ p := b.buf[b.pos:]
+ if len(p) > proto.MaxUint32 {
+ panic(fmt.Errorf("pq: message too large (%d > math.MaxUint32)", len(p)))
+ }
+ binary.BigEndian.PutUint32(p, uint32(len(p)))
+ return b.buf
+}
+
+func (b *writeBuf) next(c proto.RequestCode) {
+ p := b.buf[b.pos:]
+ if len(p) > proto.MaxUint32 {
+ panic(fmt.Errorf("pq: message too large (%d > math.MaxUint32)", len(p)))
+ }
+ binary.BigEndian.PutUint32(p, uint32(len(p)))
+ b.pos = len(b.buf) + 1
+ b.buf = append(b.buf, byte(c), 0, 0, 0, 0)
+}
diff --git a/vendor/github.com/lib/pq/compose.yaml b/vendor/github.com/lib/pq/compose.yaml
@@ -0,0 +1,89 @@
+name: 'pqgo'
+
+services:
+ pgbouncer:
+ profiles: ['pgbouncer']
+ image: 'cleanstart/pgbouncer:latest'
+ ports: ['127.0.0.1:6432:6432']
+ command: ['/init/pgbouncer.ini']
+ volumes: ['./testdata/pgbouncer:/init', './testdata/ssl:/ssl']
+ environment:
+ 'PGBOUNCER_DATABASE': 'pqgo'
+
+ pgpool:
+ profiles: ['pgpool']
+ image: 'pgpool/pgpool:4.4.3'
+ ports: ['127.0.0.1:7432:7432']
+ volumes: ['./testdata/pgpool:/init', './testdata/ssl:/ssl']
+ entrypoint: '/init/entry.sh'
+ environment:
+ 'PGPOOL_PARAMS_PORT': '7432'
+ 'PGPOOL_PARAMS_BACKEND_HOSTNAME0': 'pg18'
+
+ cockroach:
+ profiles: ['cockroach']
+ image: 'cockroachdb/cockroach:latest-v26.1'
+ ports: ['127.0.0.1:26257:26257']
+ volumes: ['./testdata/cockroach:/docker-entrypoint-initdb.d', './testdata/ssl:/ssl']
+ command: ['start-single-node', '--accept-sql-without-tls', '--certs-dir=/ssl2']
+ healthcheck: {test: ['CMD-SHELL', '/cockroach/cockroach node status --insecure --user=pqgo'], start_period: '30s', start_interval: '1s'}
+
+ pg18:
+ image: 'postgres:18'
+ ports: ['127.0.0.1:5432:5432']
+ entrypoint: '/init/entry.sh'
+ volumes: ['./testdata/postgres:/init', './testdata/ssl:/ssl']
+ shm_size: '128mb'
+ healthcheck: {test: ['CMD-SHELL', 'pg_isready -U pqgo -d pqgo'], start_period: '30s', start_interval: '1s'}
+ environment:
+ 'POSTGRES_DATABASE': 'pqgo'
+ 'POSTGRES_USER': 'pqgo'
+ 'POSTGRES_PASSWORD': 'unused'
+ pg17:
+ profiles: ['pg17']
+ image: 'postgres:17'
+ ports: ['127.0.0.1:5432:5432']
+ entrypoint: '/init/entry.sh'
+ volumes: ['./testdata/postgres:/init', './testdata/ssl:/ssl']
+ shm_size: '128mb'
+ healthcheck: {test: ['CMD-SHELL', 'pg_isready -U pqgo -d pqgo'], start_period: '30s', start_interval: '1s'}
+ environment:
+ 'POSTGRES_DATABASE': 'pqgo'
+ 'POSTGRES_USER': 'pqgo'
+ 'POSTGRES_PASSWORD': 'unused'
+ pg16:
+ profiles: ['pg16']
+ image: 'postgres:16'
+ ports: ['127.0.0.1:5432:5432']
+ entrypoint: '/init/entry.sh'
+ volumes: ['./testdata/postgres:/init', './testdata/ssl:/ssl']
+ shm_size: '128mb'
+ healthcheck: {test: ['CMD-SHELL', 'pg_isready -U pqgo -d pqgo'], start_period: '30s', start_interval: '1s'}
+ environment:
+ 'POSTGRES_DATABASE': 'pqgo'
+ 'POSTGRES_USER': 'pqgo'
+ 'POSTGRES_PASSWORD': 'unused'
+ pg15:
+ profiles: ['pg15']
+ image: 'postgres:15'
+ ports: ['127.0.0.1:5432:5432']
+ entrypoint: '/init/entry.sh'
+ volumes: ['./testdata/postgres:/init', './testdata/ssl:/ssl']
+ shm_size: '128mb'
+ healthcheck: {test: ['CMD-SHELL', 'pg_isready -U pqgo -d pqgo'], start_period: '30s', start_interval: '1s'}
+ environment:
+ 'POSTGRES_DATABASE': 'pqgo'
+ 'POSTGRES_USER': 'pqgo'
+ 'POSTGRES_PASSWORD': 'unused'
+ pg14:
+ profiles: ['pg14']
+ image: 'postgres:14'
+ ports: ['127.0.0.1:5432:5432']
+ entrypoint: '/init/entry.sh'
+ volumes: ['./testdata/postgres:/init', './testdata/ssl:/ssl']
+ shm_size: '128mb'
+ healthcheck: {test: ['CMD-SHELL', 'pg_isready -U pqgo -d pqgo'], start_period: '30s', start_interval: '1s'}
+ environment:
+ 'POSTGRES_DATABASE': 'pqgo'
+ 'POSTGRES_USER': 'pqgo'
+ 'POSTGRES_PASSWORD': 'unused'
diff --git a/vendor/github.com/lib/pq/conn.go b/vendor/github.com/lib/pq/conn.go
@@ -0,0 +1,1818 @@
+package pq
+
+import (
+ "bufio"
+ "context"
+ "crypto/md5"
+ "crypto/sha256"
+ "database/sql"
+ "database/sql/driver"
+ "encoding/binary"
+ "errors"
+ "fmt"
+ "io"
+ "math"
+ "net"
+ "os"
+ "reflect"
+ "strconv"
+ "strings"
+ "sync"
+ "sync/atomic"
+ "time"
+
+ "github.com/lib/pq/internal/pgpass"
+ "github.com/lib/pq/internal/pqsql"
+ "github.com/lib/pq/internal/pqutil"
+ "github.com/lib/pq/internal/proto"
+ "github.com/lib/pq/oid"
+ "github.com/lib/pq/scram"
+)
+
+// Common error types
+var (
+ ErrNotSupported = errors.New("pq: unsupported command")
+ ErrInFailedTransaction = errors.New("pq: could not complete operation in a failed transaction")
+ ErrSSLNotSupported = errors.New("pq: SSL is not enabled on the server")
+ ErrCouldNotDetectUsername = errors.New("pq: could not detect default username; please provide one explicitly")
+ ErrSSLKeyUnknownOwnership = pqutil.ErrSSLKeyUnknownOwnership
+ ErrSSLKeyHasWorldPermissions = pqutil.ErrSSLKeyHasWorldPermissions
+
+ errQueryInProgress = errors.New("pq: there is already a query being processed on this connection")
+ errUnexpectedReady = errors.New("unexpected ReadyForQuery")
+ errNoRowsAffected = errors.New("no RowsAffected available after the empty statement")
+ errNoLastInsertID = errors.New("no LastInsertId available after the empty statement")
+)
+
+// Compile time validation that our types implement the expected interfaces
+var (
+ _ driver.Driver = Driver{}
+ _ driver.ConnBeginTx = (*conn)(nil)
+ _ driver.ConnPrepareContext = (*conn)(nil)
+ _ driver.Execer = (*conn)(nil) //lint:ignore SA1019 x
+ _ driver.ExecerContext = (*conn)(nil)
+ _ driver.NamedValueChecker = (*conn)(nil)
+ _ driver.Pinger = (*conn)(nil)
+ _ driver.Queryer = (*conn)(nil) //lint:ignore SA1019 x
+ _ driver.QueryerContext = (*conn)(nil)
+ _ driver.SessionResetter = (*conn)(nil)
+ _ driver.Validator = (*conn)(nil)
+ _ driver.StmtExecContext = (*stmt)(nil)
+ _ driver.StmtQueryContext = (*stmt)(nil)
+)
+
+func init() {
+ sql.Register("postgres", &Driver{})
+}
+
+var debugProto = func() bool {
+ // Check for exactly "1" (rather than mere existence) so we can add
+ // options/flags in the future. I don't know if we ever want that, but it's
+ // nice to leave the option open.
+ return os.Getenv("PQGO_DEBUG") == "1"
+}()
+
+// Driver is the Postgres database driver.
+type Driver struct{}
+
+// Open opens a new connection to the database. name is a connection string.
+// Most users should only use it through database/sql package from the standard
+// library.
+func (d Driver) Open(name string) (driver.Conn, error) {
+ return Open(name)
+}
+
+// Parameters sent by PostgreSQL on startup.
+type parameterStatus struct {
+ serverVersion int
+ currentLocation *time.Location
+ inHotStandby, defaultTransactionReadOnly sql.NullBool
+}
+
+type format int
+
+const (
+ formatText format = 0
+ formatBinary format = 1
+)
+
+var (
+ // One result-column format code with the value 1 (i.e. all binary).
+ colFmtDataAllBinary = []byte{0, 1, 0, 1}
+
+ // No result-column format codes (i.e. all text).
+ colFmtDataAllText = []byte{0, 0}
+)
+
+type transactionStatus byte
+
+const (
+ txnStatusIdle transactionStatus = 'I'
+ txnStatusIdleInTransaction transactionStatus = 'T'
+ txnStatusInFailedTransaction transactionStatus = 'E'
+)
+
+func (s transactionStatus) String() string {
+ switch s {
+ case txnStatusIdle:
+ return "idle"
+ case txnStatusIdleInTransaction:
+ return "idle in transaction"
+ case txnStatusInFailedTransaction:
+ return "in a failed transaction"
+ default:
+ panic(fmt.Sprintf("pq: unknown transactionStatus %d", s))
+ }
+}
+
+// Dialer is the dialer interface. It can be used to obtain more control over
+// how pq creates network connections.
+type Dialer interface {
+ Dial(network, address string) (net.Conn, error)
+ DialTimeout(network, address string, timeout time.Duration) (net.Conn, error)
+}
+
+// DialerContext is the context-aware dialer interface.
+type DialerContext interface {
+ DialContext(ctx context.Context, network, address string) (net.Conn, error)
+}
+
+type defaultDialer struct {
+ d net.Dialer
+}
+
+func (d defaultDialer) Dial(network, address string) (net.Conn, error) {
+ return d.d.Dial(network, address)
+}
+
+func (d defaultDialer) DialTimeout(network, address string, timeout time.Duration) (net.Conn, error) {
+ ctx, cancel := context.WithTimeout(context.Background(), timeout)
+ defer cancel()
+ return d.DialContext(ctx, network, address)
+}
+
+func (d defaultDialer) DialContext(ctx context.Context, network, address string) (net.Conn, error) {
+ return d.d.DialContext(ctx, network, address)
+}
+
+type conn struct {
+ c net.Conn
+ buf *bufio.Reader
+ namei int
+ scratch [512]byte
+ txnStatus transactionStatus
+ txnFinish func()
+
+ // Save connection arguments to use during CancelRequest.
+ dialer Dialer
+ cfg Config
+ parameterStatus parameterStatus
+
+ saveMessageType proto.ResponseCode
+ saveMessageBuffer []byte
+
+ // If an error is set this connection is bad and all public-facing
+ // functions should return the appropriate error by calling get()
+ // (ErrBadConn) or getForNext().
+ err syncErr
+
+ secretKey []byte // Cancellation key for CancelRequest messages.
+ pid int // Cancellation PID.
+ inProgress atomic.Bool // This connection is in the middle of a processing a request.
+ noticeHandler func(*Error) // If not nil, notices will be synchronously sent here
+ notificationHandler func(*Notification) // If not nil, notifications will be synchronously sent here
+ gss GSS // GSSAPI context
+}
+
+type syncErr struct {
+ err error
+ sync.Mutex
+}
+
+// Return ErrBadConn if connection is bad.
+func (e *syncErr) get() error {
+ e.Lock()
+ defer e.Unlock()
+ if e.err != nil {
+ return driver.ErrBadConn
+ }
+ return nil
+}
+
+// Return the error set on the connection. Currently only used by rows.Next.
+func (e *syncErr) getForNext() error {
+ e.Lock()
+ defer e.Unlock()
+ return e.err
+}
+
+// Set error, only if it isn't set yet.
+func (e *syncErr) set(err error) {
+ if err == nil {
+ panic("attempt to set nil err")
+ }
+ e.Lock()
+ defer e.Unlock()
+ if e.err == nil {
+ e.err = err
+ }
+}
+
+func (cn *conn) writeBuf(b proto.RequestCode) *writeBuf {
+ cn.scratch[0] = byte(b)
+ return &writeBuf{
+ buf: cn.scratch[:5],
+ pos: 1,
+ }
+}
+
+// Open opens a new connection to the database. dsn is a connection string. Most
+// users should only use it through database/sql package from the standard
+// library.
+func Open(dsn string) (_ driver.Conn, err error) {
+ return DialOpen(defaultDialer{}, dsn)
+}
+
+// DialOpen opens a new connection to the database using a dialer.
+func DialOpen(d Dialer, dsn string) (_ driver.Conn, err error) {
+ c, err := NewConnector(dsn)
+ if err != nil {
+ return nil, err
+ }
+ c.Dialer(d)
+ return c.open(context.Background())
+}
+
+func (c *Connector) open(ctx context.Context) (*conn, error) {
+ tsa := c.cfg.TargetSessionAttrs
+restartAll:
+ var (
+ errs []error
+ app = func(err error, cfg Config) bool {
+ if err != nil {
+ if debugProto {
+ fmt.Fprintln(os.Stderr, "CONNECT (error)", err)
+ }
+ errs = append(errs, fmt.Errorf("connecting to %s:%d: %w", cfg.Host, cfg.Port, err))
+ }
+ return err != nil
+ }
+ )
+ for _, cfg := range c.cfg.hosts() {
+ mode := cfg.SSLMode
+ restartHost:
+ if debugProto {
+ fmt.Fprintln(os.Stderr, "CONNECT ", cfg.string())
+ }
+
+ cfg.SSLMode = mode
+ cn := &conn{cfg: cfg, dialer: c.dialer}
+ cn.cfg.Password = pgpass.PasswordFromPgpass(cn.cfg.Passfile, cn.cfg.User, cn.cfg.Password,
+ cn.cfg.Host, strconv.Itoa(int(cn.cfg.Port)), cn.cfg.Database)
+
+ var err error
+ cn.c, err = dial(ctx, c.dialer, cn.cfg)
+ if app(err, cfg) {
+ continue
+ }
+
+ err = cn.ssl(cn.cfg, mode)
+ if err != nil && mode == SSLModePrefer {
+ mode = SSLModeDisable
+ goto restartHost
+ }
+ if app(err, cfg) {
+ if cn.c != nil {
+ _ = cn.c.Close()
+ }
+ continue
+ }
+
+ cn.buf = bufio.NewReader(cn.c)
+ err = cn.startup(cn.cfg)
+ if err != nil && mode == SSLModeAllow {
+ mode = SSLModeRequire
+ goto restartHost
+ }
+ if app(err, cfg) {
+ _ = cn.c.Close()
+ continue
+ }
+
+ // Reset the deadline, in case one was set (see dial)
+ if cn.cfg.ConnectTimeout > 0 {
+ err := cn.c.SetDeadline(time.Time{})
+ if app(err, cfg) {
+ _ = cn.c.Close()
+ continue
+ }
+ }
+
+ err = cn.checkTSA(tsa)
+ if app(err, cfg) {
+ _ = cn.c.Close()
+ continue
+ }
+
+ return cn, nil
+ }
+
+ // target_session_attrs=prefer-standby is treated as standby in checkTSA; we
+ // ran out of hosts so none are on standby. Clear the setting and try again.
+ if c.cfg.TargetSessionAttrs == TargetSessionAttrsPreferStandby {
+ tsa = TargetSessionAttrsAny
+ goto restartAll
+ }
+
+ if len(c.cfg.Multi) == 0 {
+ // Remove the "connecting to [..]" when we have just one host, so the
+ // error is identical to what we had before.
+ return nil, errors.Unwrap(errs[0])
+ }
+ return nil, fmt.Errorf("pq: could not connect to any of the hosts:\n%w", errors.Join(errs...))
+}
+
+func (cn *conn) getBool(query string) (bool, error) {
+ res, err := cn.simpleQuery(query)
+ if err != nil {
+ return false, err
+ }
+ defer res.Close()
+
+ v := make([]driver.Value, 1)
+ err = res.Next(v)
+ if err != nil {
+ return false, err
+ }
+
+ switch vv := v[0].(type) {
+ default:
+ return false, fmt.Errorf("parseBool: unknown type %T: %[1]v", v[0])
+ case bool:
+ return vv, nil
+ case string:
+ vv, ok := v[0].(string)
+ if !ok {
+ return false, err
+ }
+ return vv == "on", nil
+ }
+}
+
+func (cn *conn) checkTSA(tsa TargetSessionAttrs) error {
+ var (
+ geths = func() (hs bool, err error) {
+ hs = cn.parameterStatus.inHotStandby.Bool
+ if !cn.parameterStatus.inHotStandby.Valid {
+ hs, err = cn.getBool("select pg_catalog.pg_is_in_recovery()")
+ }
+ return hs, err
+ }
+ getro = func() (ro bool, err error) {
+ ro = cn.parameterStatus.defaultTransactionReadOnly.Bool
+ if !cn.parameterStatus.defaultTransactionReadOnly.Valid {
+ ro, err = cn.getBool("show transaction_read_only")
+ }
+ return ro, err
+ }
+ )
+
+ switch tsa {
+ default:
+ panic("unreachable")
+ case "", TargetSessionAttrsAny:
+ return nil
+ case TargetSessionAttrsReadWrite, TargetSessionAttrsReadOnly:
+ readonly, err := getro()
+ if err != nil {
+ return err
+ }
+ if !cn.parameterStatus.defaultTransactionReadOnly.Valid {
+ var err error
+ readonly, err = cn.getBool("show transaction_read_only")
+ if err != nil {
+ return err
+ }
+ }
+ switch {
+ case tsa == TargetSessionAttrsReadOnly && !readonly:
+ return errors.New("session is not read-only")
+ case tsa == TargetSessionAttrsReadWrite:
+ if readonly {
+ return errors.New("session is read-only")
+ }
+ hs, err := geths()
+ if err != nil {
+ return err
+ }
+ if hs {
+ return errors.New("server is in hot standby mode")
+ }
+ return nil
+ default:
+ return nil
+ }
+ case TargetSessionAttrsPrimary, TargetSessionAttrsStandby, TargetSessionAttrsPreferStandby:
+ hs, err := geths()
+ if err != nil {
+ return err
+ }
+ switch {
+ case (tsa == TargetSessionAttrsStandby || tsa == TargetSessionAttrsPreferStandby) && !hs:
+ return errors.New("server is not in hot standby mode")
+ case tsa == TargetSessionAttrsPrimary && hs:
+ return errors.New("server is in hot standby mode")
+ default:
+ return nil
+ }
+ }
+}
+
+func dial(ctx context.Context, d Dialer, cfg Config) (net.Conn, error) {
+ network, address := cfg.network()
+
+ // Zero or not specified means wait indefinitely.
+ if cfg.ConnectTimeout > 0 {
+ // connect_timeout should apply to the entire connection establishment
+ // procedure, so we both use a timeout for the TCP connection
+ // establishment and set a deadline for doing the initial handshake. The
+ // deadline is then reset after startup() is done.
+ var (
+ deadline = time.Now().Add(cfg.ConnectTimeout)
+ conn net.Conn
+ err error
+ )
+ if dctx, ok := d.(DialerContext); ok {
+ ctx, cancel := context.WithTimeout(ctx, cfg.ConnectTimeout)
+ defer cancel()
+ conn, err = dctx.DialContext(ctx, network, address)
+ } else {
+ conn, err = d.DialTimeout(network, address, cfg.ConnectTimeout)
+ }
+ if err != nil {
+ return nil, err
+ }
+ err = conn.SetDeadline(deadline)
+ return conn, err
+ }
+ if dctx, ok := d.(DialerContext); ok {
+ return dctx.DialContext(ctx, network, address)
+ }
+ return d.Dial(network, address)
+}
+
+func (cn *conn) isInTransaction() bool {
+ return cn.txnStatus == txnStatusIdleInTransaction ||
+ cn.txnStatus == txnStatusInFailedTransaction
+}
+
+func (cn *conn) checkIsInTransaction(intxn bool) error {
+ if cn.isInTransaction() != intxn {
+ cn.err.set(driver.ErrBadConn)
+ return fmt.Errorf("pq: unexpected transaction status %v", cn.txnStatus)
+ }
+ return nil
+}
+
+func (cn *conn) Begin() (_ driver.Tx, err error) {
+ return cn.begin("")
+}
+
+func (cn *conn) begin(mode string) (_ driver.Tx, err error) {
+ if err := cn.err.get(); err != nil {
+ return nil, err
+ }
+ if err := cn.checkIsInTransaction(false); err != nil {
+ return nil, err
+ }
+
+ _, commandTag, err := cn.simpleExec("BEGIN" + mode)
+ if err != nil {
+ return nil, cn.handleError(err)
+ }
+ if commandTag != "BEGIN" {
+ cn.err.set(driver.ErrBadConn)
+ return nil, fmt.Errorf("unexpected command tag %s", commandTag)
+ }
+ if cn.txnStatus != txnStatusIdleInTransaction {
+ cn.err.set(driver.ErrBadConn)
+ return nil, fmt.Errorf("unexpected transaction status %v", cn.txnStatus)
+ }
+ return cn, nil
+}
+
+func (cn *conn) closeTxn() {
+ if finish := cn.txnFinish; finish != nil {
+ finish()
+ }
+}
+
+func (cn *conn) Commit() error {
+ defer cn.closeTxn()
+ if err := cn.err.get(); err != nil {
+ return err
+ }
+ if err := cn.checkIsInTransaction(true); err != nil {
+ return err
+ }
+
+ // We don't want the client to think that everything is okay if it tries
+ // to commit a failed transaction. However, no matter what we return,
+ // database/sql will release this connection back into the free connection
+ // pool so we have to abort the current transaction here. Note that you
+ // would get the same behaviour if you issued a COMMIT in a failed
+ // transaction, so it's also the least surprising thing to do here.
+ if cn.txnStatus == txnStatusInFailedTransaction {
+ if err := cn.rollback(); err != nil {
+ return err
+ }
+ return ErrInFailedTransaction
+ }
+
+ _, commandTag, err := cn.simpleExec("COMMIT")
+ if err != nil {
+ if cn.isInTransaction() {
+ cn.err.set(driver.ErrBadConn)
+ }
+ return cn.handleError(err)
+ }
+ if commandTag != "COMMIT" {
+ cn.err.set(driver.ErrBadConn)
+ return fmt.Errorf("unexpected command tag %s", commandTag)
+ }
+ return cn.checkIsInTransaction(false)
+}
+
+func (cn *conn) Rollback() error {
+ defer cn.closeTxn()
+ if err := cn.err.get(); err != nil {
+ return err
+ }
+
+ err := cn.rollback()
+ if err != nil {
+ return cn.handleError(err)
+ }
+ return nil
+}
+
+func (cn *conn) rollback() (err error) {
+ if err := cn.checkIsInTransaction(true); err != nil {
+ return err
+ }
+
+ _, commandTag, err := cn.simpleExec("ROLLBACK")
+ if err != nil {
+ if cn.isInTransaction() {
+ cn.err.set(driver.ErrBadConn)
+ }
+ return err
+ }
+ if commandTag != "ROLLBACK" {
+ return fmt.Errorf("unexpected command tag %s", commandTag)
+ }
+ return cn.checkIsInTransaction(false)
+}
+
+func (cn *conn) gname() string {
+ cn.namei++
+ return strconv.FormatInt(int64(cn.namei), 10)
+}
+
+func (cn *conn) simpleExec(q string) (res driver.Result, commandTag string, resErr error) {
+ if debugProto {
+ fmt.Fprintln(os.Stderr, " START conn.simpleExec")
+ defer fmt.Fprintln(os.Stderr, " END conn.simpleExec")
+ }
+
+ b := cn.writeBuf(proto.Query)
+ b.string(q)
+ err := cn.send(b)
+ if err != nil {
+ return nil, "", err
+ }
+
+ for {
+ t, r, err := cn.recv1()
+ if err != nil {
+ return nil, "", err
+ }
+ switch t {
+ case proto.CommandComplete:
+ res, commandTag, err = cn.parseComplete(r.string())
+ if err != nil {
+ return nil, "", err
+ }
+ case proto.ReadyForQuery:
+ cn.processReadyForQuery(r)
+ if res == nil && resErr == nil {
+ resErr = errUnexpectedReady
+ }
+ return res, commandTag, resErr
+ case proto.ErrorResponse:
+ resErr = parseError(r, q)
+ case proto.EmptyQueryResponse:
+ res = emptyRows
+ case proto.RowDescription, proto.DataRow:
+ // ignore any results
+ default:
+ cn.err.set(driver.ErrBadConn)
+ return nil, "", fmt.Errorf("pq: unknown response for simple query: %q", t)
+ }
+ }
+}
+
+func (cn *conn) simpleQuery(q string) (*rows, error) {
+ if debugProto {
+ fmt.Fprintln(os.Stderr, " START conn.simpleQuery")
+ defer fmt.Fprintln(os.Stderr, " END conn.simpleQuery")
+ }
+
+ b := cn.writeBuf(proto.Query)
+ b.string(q)
+ err := cn.send(b)
+ if err != nil {
+ return nil, cn.handleError(err, q)
+ }
+
+ var (
+ res *rows
+ resErr error
+ )
+ for {
+ t, r, err := cn.recv1()
+ if err != nil {
+ return nil, cn.handleError(err, q)
+ }
+ switch t {
+ case proto.CommandComplete, proto.EmptyQueryResponse:
+ // We allow queries which don't return any results through Query as
+ // well as Exec. We still have to give database/sql a rows object
+ // the user can close, though, to avoid connections from being
+ // leaked. A "rows" with done=true works fine for that purpose.
+ if resErr != nil {
+ cn.err.set(driver.ErrBadConn)
+ return nil, fmt.Errorf("pq: unexpected message %q in simple query execution", t)
+ }
+ if res == nil {
+ res = &rows{cn: cn}
+ }
+ // Set the result and tag to the last command complete if there wasn't a
+ // query already run. Although queries usually return from here and cede
+ // control to Next, a query with zero results does not.
+ if t == proto.CommandComplete {
+ res.result, res.tag, err = cn.parseComplete(r.string())
+ if err != nil {
+ return nil, cn.handleError(err, q)
+ }
+ if res.colNames != nil {
+ return res, cn.handleError(resErr, q)
+ }
+ }
+ res.done = true
+ case proto.ReadyForQuery:
+ cn.processReadyForQuery(r)
+ if err == nil && res == nil {
+ res = &rows{done: true}
+ }
+ return res, cn.handleError(resErr, q) // done
+ case proto.ErrorResponse:
+ res = nil
+ resErr = parseError(r, q)
+ case proto.DataRow:
+ if res == nil {
+ cn.err.set(driver.ErrBadConn)
+ return nil, fmt.Errorf("pq: unexpected DataRow in simple query execution")
+ }
+ return res, cn.saveMessage(t, r) // The query didn't fail; kick off to Next
+ case proto.RowDescription:
+ // res might be non-nil here if we received a previous
+ // CommandComplete, but that's fine and just overwrite it.
+ res = &rows{cn: cn, rowsHeader: parsePortalRowDescribe(r)}
+
+ // To work around a bug in QueryRow in Go 1.2 and earlier, wait
+ // until the first DataRow has been received.
+ default:
+ cn.err.set(driver.ErrBadConn)
+ return nil, fmt.Errorf("pq: unknown response for simple query: %q", t)
+ }
+ }
+}
+
+// Decides which column formats to use for a prepared statement. The input is
+// an array of type oids, one element per result column.
+func decideColumnFormats(colTyps []fieldDesc, forceText bool) (colFmts []format, colFmtData []byte, _ error) {
+ if len(colTyps) == 0 {
+ return nil, colFmtDataAllText, nil
+ }
+
+ colFmts = make([]format, len(colTyps))
+ if forceText {
+ return colFmts, colFmtDataAllText, nil
+ }
+
+ allBinary := true
+ allText := true
+ for i, t := range colTyps {
+ switch t.OID {
+ // This is the list of types to use binary mode for when receiving them
+ // through a prepared statement. If a type appears in this list, it
+ // must also be implemented in binaryDecode in encode.go.
+ case oid.T_bytea:
+ fallthrough
+ case oid.T_int8:
+ fallthrough
+ case oid.T_int4:
+ fallthrough
+ case oid.T_int2:
+ fallthrough
+ case oid.T_uuid:
+ colFmts[i] = formatBinary
+ allText = false
+ default:
+ allBinary = false
+ }
+ }
+
+ if allBinary {
+ return colFmts, colFmtDataAllBinary, nil
+ } else if allText {
+ return colFmts, colFmtDataAllText, nil
+ } else {
+ colFmtData = make([]byte, 2+len(colFmts)*2)
+ if len(colFmts) > math.MaxUint16 {
+ return nil, nil, fmt.Errorf("pq: too many columns (%d > math.MaxUint16)", len(colFmts))
+ }
+ binary.BigEndian.PutUint16(colFmtData, uint16(len(colFmts)))
+ for i, v := range colFmts {
+ binary.BigEndian.PutUint16(colFmtData[2+i*2:], uint16(v))
+ }
+ return colFmts, colFmtData, nil
+ }
+}
+
+func (cn *conn) prepareTo(q, stmtName string) (*stmt, error) {
+ if debugProto {
+ fmt.Fprintln(os.Stderr, " START conn.prepareTo")
+ defer fmt.Fprintln(os.Stderr, " END conn.prepareTo")
+ }
+
+ st := &stmt{cn: cn, name: stmtName}
+
+ b := cn.writeBuf(proto.Parse)
+ b.string(st.name)
+ b.string(q)
+ b.int16(0)
+
+ b.next(proto.Describe)
+ b.byte(proto.Sync)
+ b.string(st.name)
+
+ b.next(proto.Sync)
+ err := cn.send(b)
+ if err != nil {
+ return nil, err
+ }
+
+ err = cn.readParseResponse()
+ if err != nil {
+ return nil, err
+ }
+ st.paramTyps, st.colNames, st.colTyps, err = cn.readStatementDescribeResponse()
+ if err != nil {
+ return nil, err
+ }
+ st.colFmts, st.colFmtData, err = decideColumnFormats(st.colTyps, cn.cfg.DisablePreparedBinaryResult)
+ if err != nil {
+ return nil, err
+ }
+
+ err = cn.readReadyForQuery()
+ if err != nil {
+ return nil, err
+ }
+ return st, nil
+}
+
+func (cn *conn) Prepare(q string) (driver.Stmt, error) {
+ if err := cn.err.get(); err != nil {
+ return nil, err
+ }
+
+ if pqsql.StartsWithCopy(q) {
+ s, err := cn.prepareCopyIn(q)
+ if err == nil {
+ cn.inProgress.Store(true)
+ }
+ return s, cn.handleError(err, q)
+ }
+ s, err := cn.prepareTo(q, cn.gname())
+ if err != nil {
+ return nil, cn.handleError(err, q)
+ }
+ return s, nil
+}
+
+func (cn *conn) Close() error {
+ // Don't go through send(); ListenerConn relies on us not scribbling on the
+ // scratch buffer of this connection.
+ err := cn.sendSimpleMessage(proto.Terminate)
+ if err != nil {
+ _ = cn.c.Close() // Ensure that cn.c.Close is always run.
+ return cn.handleError(err)
+ }
+ return cn.c.Close()
+}
+
+func toNamedValue(v []driver.Value) []driver.NamedValue {
+ v2 := make([]driver.NamedValue, len(v))
+ for i := range v {
+ v2[i] = driver.NamedValue{Ordinal: i + 1, Value: v[i]}
+ }
+ return v2
+}
+
+// CheckNamedValue implements [driver.NamedValueChecker].
+func (cn *conn) CheckNamedValue(nv *driver.NamedValue) error {
+ if cn.cfg.BinaryParameters {
+ if bin, ok := nv.Value.(interface{ BinaryValue() ([]byte, error) }); ok {
+ var err error
+ nv.Value, err = bin.BinaryValue()
+ return err
+ }
+ }
+
+ // Ignore Valuer, for backward compatibility with pq.Array().
+ if _, ok := nv.Value.(driver.Valuer); ok {
+ return driver.ErrSkip
+ }
+
+ v := reflect.ValueOf(nv.Value)
+ if !v.IsValid() {
+ return driver.ErrSkip
+ }
+ t := v.Type()
+ for t.Kind() == reflect.Pointer {
+ t, v = t.Elem(), v.Elem()
+ }
+
+ // Ignore []byte and related types: *[]byte, json.RawMessage, etc.
+ if t.Kind() == reflect.Slice && t.Elem().Kind() == reflect.Uint8 {
+ return driver.ErrSkip
+ }
+
+ switch v.Kind() {
+ default:
+ return driver.ErrSkip
+ case reflect.Slice:
+ var err error
+ nv.Value, err = Array(v.Interface()).Value()
+ return err
+ case reflect.Uint64:
+ value := v.Uint()
+ if value >= math.MaxInt64 {
+ nv.Value = strconv.FormatUint(value, 10)
+ } else {
+ nv.Value = int64(value)
+ }
+ return nil
+ }
+}
+
+// Implement the "Queryer" interface
+func (cn *conn) Query(query string, args []driver.Value) (driver.Rows, error) {
+ return cn.query(query, toNamedValue(args))
+}
+
+func (cn *conn) query(query string, args []driver.NamedValue) (*rows, error) {
+ if debugProto {
+ fmt.Fprintln(os.Stderr, " START conn.query")
+ defer fmt.Fprintln(os.Stderr, " END conn.query")
+ }
+ if err := cn.err.get(); err != nil {
+ return nil, err
+ }
+ if !cn.inProgress.CompareAndSwap(false, true) {
+ return nil, errQueryInProgress
+ }
+
+ // Check to see if we can use the "simpleQuery" interface, which is
+ // *much* faster than going through prepare/exec
+ if len(args) == 0 {
+ return cn.simpleQuery(query)
+ }
+
+ if cn.cfg.BinaryParameters {
+ err := cn.sendBinaryModeQuery(query, args)
+ if err != nil {
+ return nil, cn.handleError(err, query)
+ }
+ err = cn.readParseResponse()
+ if err != nil {
+ return nil, cn.handleError(err, query)
+ }
+ err = cn.readBindResponse()
+ if err != nil {
+ return nil, cn.handleError(err, query)
+ }
+
+ rows := &rows{cn: cn}
+ rows.rowsHeader, err = cn.readPortalDescribeResponse()
+ if err != nil {
+ return nil, cn.handleError(err, query)
+ }
+ err = cn.postExecuteWorkaround()
+ if err != nil {
+ return nil, cn.handleError(err, query)
+ }
+ return rows, nil
+ }
+
+ st, err := cn.prepareTo(query, "")
+ if err != nil {
+ return nil, cn.handleError(err, query)
+ }
+ err = st.exec(args)
+ if err != nil {
+ return nil, cn.handleError(err, query)
+ }
+ return &rows{
+ cn: cn,
+ rowsHeader: st.rowsHeader,
+ }, nil
+}
+
+// Implement the optional "Execer" interface for one-shot queries
+func (cn *conn) Exec(query string, args []driver.Value) (driver.Result, error) {
+ if err := cn.err.get(); err != nil {
+ return nil, err
+ }
+ if !cn.inProgress.CompareAndSwap(false, true) {
+ return nil, errQueryInProgress
+ }
+
+ // Check to see if we can use the "simpleExec" interface, which is *much*
+ // faster than going through prepare/exec
+ if len(args) == 0 {
+ // ignore commandTag, our caller doesn't care
+ r, _, err := cn.simpleExec(query)
+ return r, cn.handleError(err, query)
+ }
+
+ if cn.cfg.BinaryParameters {
+ err := cn.sendBinaryModeQuery(query, toNamedValue(args))
+ if err != nil {
+ return nil, cn.handleError(err, query)
+ }
+ err = cn.readParseResponse()
+ if err != nil {
+ return nil, cn.handleError(err, query)
+ }
+ err = cn.readBindResponse()
+ if err != nil {
+ return nil, cn.handleError(err, query)
+ }
+
+ _, err = cn.readPortalDescribeResponse()
+ if err != nil {
+ return nil, cn.handleError(err, query)
+ }
+ err = cn.postExecuteWorkaround()
+ if err != nil {
+ return nil, cn.handleError(err, query)
+ }
+ res, _, err := cn.readExecuteResponse("Execute")
+ return res, cn.handleError(err, query)
+ }
+
+ // Use the unnamed statement to defer planning until bind time, or else
+ // value-based selectivity estimates cannot be used.
+ st, err := cn.prepareTo(query, "")
+ if err != nil {
+ return nil, cn.handleError(err, query)
+ }
+ r, err := st.Exec(args)
+ if err != nil {
+ return nil, cn.handleError(err, query)
+ }
+ return r, nil
+}
+
+type safeRetryError struct{ Err error }
+
+func (se *safeRetryError) Error() string { return se.Err.Error() }
+
+func (cn *conn) send(m *writeBuf) error {
+ if debugProto {
+ w := m.wrap()
+ for len(w) > 0 { // Can contain multiple messages.
+ c := proto.RequestCode(w[0])
+ l := int(binary.BigEndian.Uint32(w[1:5])) - 4
+ fmt.Fprintf(os.Stderr, "CLIENT → %-20s %5d %q\n", c, l, w[5:l+5])
+ w = w[l+5:]
+ }
+ }
+
+ n, err := cn.c.Write(m.wrap())
+ if err != nil && n == 0 {
+ err = &safeRetryError{Err: err}
+ }
+ return err
+}
+
+func (cn *conn) sendStartupPacket(m *writeBuf) error {
+ if debugProto {
+ w := m.wrap()
+ fmt.Fprintf(os.Stderr, "CLIENT → %-20s %5d %q\n", "Startup", int(binary.BigEndian.Uint32(w[1:5]))-4, w[5:])
+ }
+ _, err := cn.c.Write((m.wrap())[1:])
+ return err
+}
+
+// Send a message of type typ to the server on the other end of cn. The message
+// should have no payload. This method does not use the scratch buffer.
+func (cn *conn) sendSimpleMessage(typ proto.RequestCode) error {
+ if debugProto {
+ fmt.Fprintf(os.Stderr, "CLIENT → %-20s %5d %q\n", typ, 0, []byte{})
+ }
+ _, err := cn.c.Write([]byte{byte(typ), '\x00', '\x00', '\x00', '\x04'})
+ return err
+}
+
+// saveMessage memorizes a message and its buffer in the conn struct.
+// recvMessage will then return these values on the next call to it. This
+// method is useful in cases where you have to see what the next message is
+// going to be (e.g. to see whether it's an error or not) but you can't handle
+// the message yourself.
+func (cn *conn) saveMessage(typ proto.ResponseCode, buf *readBuf) error {
+ if cn.saveMessageType != 0 {
+ cn.err.set(driver.ErrBadConn)
+ return fmt.Errorf("unexpected saveMessageType %d", cn.saveMessageType)
+ }
+ cn.saveMessageType = typ
+ cn.saveMessageBuffer = *buf
+ return nil
+}
+
+// recvMessage receives any message from the backend, or returns an error if
+// a problem occurred while reading the message.
+func (cn *conn) recvMessage(r *readBuf) (proto.ResponseCode, error) {
+ // workaround for a QueryRow bug, see exec
+ if cn.saveMessageType != 0 {
+ t := cn.saveMessageType
+ *r = cn.saveMessageBuffer
+ cn.saveMessageType = 0
+ cn.saveMessageBuffer = nil
+ return t, nil
+ }
+
+ x := cn.scratch[:5]
+ _, err := io.ReadFull(cn.buf, x)
+ if err != nil {
+ return 0, err
+ }
+
+ // Read the type and length of the message that follows.
+ t := proto.ResponseCode(x[0])
+ n := int(binary.BigEndian.Uint32(x[1:])) - 4
+
+ if proto.ResponseCode(t) == proto.ReadyForQuery {
+ cn.inProgress.Store(false)
+ }
+
+ // When PostgreSQL cannot start a backend (e.g., an external process limit),
+ // it sends plain text like "Ecould not fork new process [..]", which
+ // doesn't use the standard encoding for the Error message.
+ //
+ // libpq checks "if ErrorResponse && (msgLength < 8 || msgLength > MAX_ERRLEN)",
+ // but check < 4 since n represents bytes remaining to be read after length.
+ if t == proto.ErrorResponse && (n < 4 || n > proto.MaxErrlen) {
+ msg, _ := cn.buf.ReadString('\x00')
+ return 0, fmt.Errorf("pq: server error: %s%s", string(x[1:]), strings.TrimSuffix(msg, "\x00"))
+ }
+
+ var y []byte
+ if n <= len(cn.scratch) {
+ y = cn.scratch[:n]
+ } else {
+ y = make([]byte, n)
+ }
+ _, err = io.ReadFull(cn.buf, y)
+ if err != nil {
+ return 0, err
+ }
+ *r = y
+ if debugProto {
+ fmt.Fprintf(os.Stderr, "SERVER ← %-20s %5d %q\n", t, n, y)
+ }
+ return t, nil
+}
+
+// recv receives a message from the backend, returning an error if an error
+// happened while reading the message or the received message an ErrorResponse.
+// NoticeResponses are ignored. This function should generally be used only
+// during the startup sequence.
+func (cn *conn) recv() (proto.ResponseCode, *readBuf, error) {
+ for {
+ r := new(readBuf)
+ t, err := cn.recvMessage(r)
+ if err != nil {
+ return 0, nil, err
+ }
+ switch t {
+ case proto.ErrorResponse:
+ return 0, nil, parseError(r, "")
+ case proto.NoticeResponse:
+ if n := cn.noticeHandler; n != nil {
+ n(parseError(r, ""))
+ }
+ case proto.NotificationResponse:
+ if n := cn.notificationHandler; n != nil {
+ n(recvNotification(r))
+ }
+ default:
+ return t, r, nil
+ }
+ }
+}
+
+// recv1Buf is exactly equivalent to recv1, except it uses a buffer supplied by
+// the caller to avoid an allocation.
+func (cn *conn) recv1Buf(r *readBuf) (proto.ResponseCode, error) {
+ for {
+ t, err := cn.recvMessage(r)
+ if err != nil {
+ return 0, err
+ }
+
+ switch t {
+ case proto.NotificationResponse:
+ if n := cn.notificationHandler; n != nil {
+ n(recvNotification(r))
+ }
+ case proto.NoticeResponse:
+ if n := cn.noticeHandler; n != nil {
+ n(parseError(r, ""))
+ }
+ case proto.ParameterStatus:
+ cn.processParameterStatus(r)
+ default:
+ return t, nil
+ }
+ }
+}
+
+// recv1 receives a message from the backend, returning an error if an error
+// happened while reading the message or the received message an ErrorResponse.
+// All asynchronous messages are ignored, with the exception of ErrorResponse.
+func (cn *conn) recv1() (proto.ResponseCode, *readBuf, error) {
+ r := new(readBuf)
+ t, err := cn.recv1Buf(r)
+ if err != nil {
+ return 0, nil, err
+ }
+ return t, r, nil
+}
+
+// Don't refer to Config.SSLMode here, as the mode in arguments may be different
+// in case of sslmode=allow or prefer.
+func (cn *conn) ssl(cfg Config, mode SSLMode) error {
+ upgrade, err := ssl(cfg, mode)
+ if err != nil {
+ return err
+ }
+ if upgrade == nil {
+ return nil // Nothing to do
+ }
+
+ // Only negotiate the ssl handshake if requested (which is the default).
+ // sslnegotiation=direct is supported by pg17 and above.
+ if cfg.SSLNegotiation != SSLNegotiationDirect {
+ w := cn.writeBuf(0)
+ w.int32(proto.NegotiateSSLCode)
+ if err = cn.sendStartupPacket(w); err != nil {
+ return err
+ }
+
+ b := cn.scratch[:1]
+ _, err = io.ReadFull(cn.c, b)
+ if err != nil {
+ return err
+ }
+
+ if b[0] != 'S' {
+ return ErrSSLNotSupported
+ }
+ }
+
+ cn.c, err = upgrade(cn.c)
+ return err
+}
+
+func (cn *conn) startup(cfg Config) error {
+ w := cn.writeBuf(0)
+ // Send maximum protocol version in startup; if the server doesn't support
+ // this version it responds with NegotiateProtocolVersion and the maximum
+ // version it supports (and will use).
+ w.int32(cfg.MaxProtocolVersion.proto())
+
+ if cfg.User != "" {
+ w.string("user")
+ w.string(cfg.User)
+ }
+ if cfg.Database != "" {
+ w.string("database")
+ w.string(cfg.Database)
+ }
+ // w.string("replication") // Sent by libpq, but we don't support that.
+ if cfg.Options != "" {
+ w.string("options")
+ w.string(cfg.Options)
+ }
+ if cfg.ApplicationName != "" {
+ w.string("application_name")
+ w.string(cfg.ApplicationName)
+ }
+ if cfg.ClientEncoding != "" {
+ w.string("client_encoding")
+ w.string(cfg.ClientEncoding)
+ }
+ if cfg.Datestyle != "" {
+ w.string("datestyle")
+ w.string(cfg.Datestyle)
+ }
+ for k, v := range cfg.Runtime {
+ w.string(k)
+ w.string(v)
+ }
+
+ w.string("")
+ if err := cn.sendStartupPacket(w); err != nil {
+ return err
+ }
+
+ for {
+ t, r, err := cn.recv()
+ if err != nil {
+ return err
+ }
+ switch t {
+ case proto.BackendKeyData:
+ cn.pid = r.int32()
+ if len(*r) > 256 {
+ return fmt.Errorf("pq: cancellation key longer than 256 bytes: %d bytes", len(*r))
+ }
+ cn.secretKey = make([]byte, len(*r))
+ copy(cn.secretKey, *r)
+ case proto.ParameterStatus:
+ cn.processParameterStatus(r)
+ case proto.AuthenticationRequest:
+ err := cn.auth(r, cfg)
+ if err != nil {
+ return err
+ }
+ case proto.NegotiateProtocolVersion:
+ newestMinor := r.int32()
+ serverVersion := proto.ProtocolVersion30&0xFFFF0000 | newestMinor
+ if serverVersion < cfg.MinProtocolVersion.proto() {
+ return fmt.Errorf("pq: protocol version mismatch: min_protocol_version=%s; server supports up to 3.%d", cfg.MinProtocolVersion, newestMinor)
+ }
+ case proto.ReadyForQuery:
+ cn.processReadyForQuery(r)
+ return nil
+ default:
+ return fmt.Errorf("pq: unknown response for startup: %q", t)
+ }
+ }
+}
+
+func (cn *conn) auth(r *readBuf, cfg Config) error {
+ switch code := proto.AuthCode(r.int32()); code {
+ default:
+ return fmt.Errorf("pq: unknown authentication response: %s", code)
+ case proto.AuthReqKrb4, proto.AuthReqKrb5, proto.AuthReqCrypt, proto.AuthReqSSPI:
+ return fmt.Errorf("pq: unsupported authentication method: %s", code)
+ case proto.AuthReqOk:
+ return nil
+
+ case proto.AuthReqPassword:
+ w := cn.writeBuf(proto.PasswordMessage)
+ w.string(cfg.Password)
+ // Don't need to check AuthOk response here; auth() is called in a loop,
+ // which catches the errors and AuthReqOk responses.
+ return cn.send(w)
+
+ case proto.AuthReqMD5:
+ s := string(r.next(4))
+ w := cn.writeBuf(proto.PasswordMessage)
+ w.string("md5" + md5s(md5s(cfg.Password+cfg.User)+s))
+ // Same here.
+ return cn.send(w)
+
+ case proto.AuthReqGSS: // GSSAPI, startup
+ if newGss == nil {
+ return fmt.Errorf("pq: kerberos error: no GSSAPI provider registered (import github.com/lib/pq/auth/kerberos)")
+ }
+ cli, err := newGss()
+ if err != nil {
+ return fmt.Errorf("pq: kerberos error: %w", err)
+ }
+
+ var token []byte
+ if cfg.KrbSpn != "" {
+ // Use the supplied SPN if provided.
+ token, err = cli.GetInitTokenFromSpn(cfg.KrbSpn)
+ } else {
+ // Allow the kerberos service name to be overridden.
+ service := "postgres"
+ if cfg.KrbSrvname != "" {
+ service = cfg.KrbSrvname
+ }
+ token, err = cli.GetInitToken(cfg.Host, service)
+ }
+ if err != nil {
+ return fmt.Errorf("pq: failed to get Kerberos ticket: %w", err)
+ }
+
+ w := cn.writeBuf(proto.GSSResponse)
+ w.bytes(token)
+ err = cn.send(w)
+ if err != nil {
+ return err
+ }
+
+ // Store for GSSAPI continue message
+ cn.gss = cli
+ return nil
+
+ case proto.AuthReqGSSCont: // GSSAPI continue
+ if cn.gss == nil {
+ return errors.New("pq: GSSAPI protocol error")
+ }
+
+ done, tokOut, err := cn.gss.Continue([]byte(*r))
+ if err == nil && !done {
+ w := cn.writeBuf(proto.SASLInitialResponse)
+ w.bytes(tokOut)
+ err = cn.send(w)
+ if err != nil {
+ return err
+ }
+ }
+
+ // Errors fall through and read the more detailed message from the
+ // server.
+ return nil
+
+ case proto.AuthReqSASL:
+ sc := scram.NewClient(sha256.New, cfg.User, cfg.Password)
+ sc.Step(nil)
+ if sc.Err() != nil {
+ return fmt.Errorf("pq: SCRAM-SHA-256 error: %w", sc.Err())
+ }
+ scOut := sc.Out()
+
+ w := cn.writeBuf(proto.SASLResponse)
+ w.string("SCRAM-SHA-256")
+ w.int32(len(scOut))
+ w.bytes(scOut)
+ err := cn.send(w)
+ if err != nil {
+ return err
+ }
+
+ t, r, err := cn.recv()
+ if err != nil {
+ return err
+ }
+ if t != proto.AuthenticationRequest {
+ return fmt.Errorf("pq: unexpected password response: %q", t)
+ }
+
+ if r.int32() != int(proto.AuthReqSASLCont) {
+ return fmt.Errorf("pq: unexpected authentication response: %q", t)
+ }
+
+ nextStep := r.next(len(*r))
+ sc.Step(nextStep)
+ if sc.Err() != nil {
+ return fmt.Errorf("pq: SCRAM-SHA-256 error: %w", sc.Err())
+ }
+
+ scOut = sc.Out()
+ w = cn.writeBuf(proto.SASLResponse)
+ w.bytes(scOut)
+ err = cn.send(w)
+ if err != nil {
+ return err
+ }
+
+ t, r, err = cn.recv()
+ if err != nil {
+ return err
+ }
+ if t != proto.AuthenticationRequest {
+ return fmt.Errorf("pq: unexpected password response: %q", t)
+ }
+
+ if r.int32() != int(proto.AuthReqSASLFin) {
+ return fmt.Errorf("pq: unexpected authentication response: %q", t)
+ }
+
+ nextStep = r.next(len(*r))
+ sc.Step(nextStep)
+ if sc.Err() != nil {
+ return fmt.Errorf("pq: SCRAM-SHA-256 error: %w", sc.Err())
+ }
+
+ return nil
+ }
+}
+
+// parseComplete parses the "command tag" from a CommandComplete message, and
+// returns the number of rows affected (if applicable) and a string identifying
+// only the command that was executed, e.g. "ALTER TABLE". Returns an error if
+// the command can cannot be parsed.
+func (cn *conn) parseComplete(commandTag string) (driver.Result, string, error) {
+ commandsWithAffectedRows := []string{
+ "SELECT ",
+ // INSERT is handled below
+ "UPDATE ",
+ "DELETE ",
+ "FETCH ",
+ "MOVE ",
+ "COPY ",
+ }
+
+ var affectedRows *string
+ for _, tag := range commandsWithAffectedRows {
+ if strings.HasPrefix(commandTag, tag) {
+ t := commandTag[len(tag):]
+ affectedRows = &t
+ commandTag = tag[:len(tag)-1]
+ break
+ }
+ }
+ // INSERT also includes the oid of the inserted row in its command tag. Oids
+ // in user tables are deprecated, and the oid is only returned when exactly
+ // one row is inserted, so it's unlikely to be of value to any real-world
+ // application and we can ignore it.
+ if affectedRows == nil && strings.HasPrefix(commandTag, "INSERT ") {
+ parts := strings.Split(commandTag, " ")
+ if len(parts) != 3 {
+ cn.err.set(driver.ErrBadConn)
+ return nil, "", fmt.Errorf("pq: unexpected INSERT command tag %s", commandTag)
+ }
+ affectedRows = &parts[len(parts)-1]
+ commandTag = "INSERT"
+ }
+ // There should be no affected rows attached to the tag, just return it
+ if affectedRows == nil {
+ return driver.RowsAffected(0), commandTag, nil
+ }
+ n, err := strconv.ParseInt(*affectedRows, 10, 64)
+ if err != nil {
+ cn.err.set(driver.ErrBadConn)
+ return nil, "", fmt.Errorf("pq: could not parse commandTag: %w", err)
+ }
+ return driver.RowsAffected(n), commandTag, nil
+}
+
+func md5s(s string) string {
+ h := md5.New()
+ h.Write([]byte(s))
+ return fmt.Sprintf("%x", h.Sum(nil))
+}
+
+func (cn *conn) sendBinaryParameters(b *writeBuf, args []driver.NamedValue) error {
+ // Do one pass over the parameters to see if we're going to send any of them
+ // over in binary. If we are, create a paramFormats array at the same time.
+ var paramFormats []int
+ for i, x := range args {
+ _, ok := x.Value.([]byte)
+ if ok {
+ if paramFormats == nil {
+ paramFormats = make([]int, len(args))
+ }
+ paramFormats[i] = 1
+ }
+ }
+ if paramFormats == nil {
+ b.int16(0)
+ } else {
+ b.int16(len(paramFormats))
+ for _, x := range paramFormats {
+ b.int16(x)
+ }
+ }
+
+ b.int16(len(args))
+ for _, x := range args {
+ if x.Value == nil {
+ b.int32(-1)
+ } else if xx, ok := x.Value.([]byte); ok && xx == nil {
+ b.int32(-1)
+ } else {
+ datum, err := binaryEncode(x.Value)
+ if err != nil {
+ return err
+ }
+ b.int32(len(datum))
+ b.bytes(datum)
+ }
+ }
+ return nil
+}
+
+func (cn *conn) sendBinaryModeQuery(query string, args []driver.NamedValue) error {
+ if len(args) >= 65536 {
+ return fmt.Errorf("pq: got %d parameters but PostgreSQL only supports 65535 parameters", len(args))
+ }
+
+ b := cn.writeBuf(proto.Parse)
+ b.byte(0) // unnamed statement
+ b.string(query)
+ b.int16(0)
+
+ b.next(proto.Bind)
+ b.int16(0) // unnamed portal and statement
+ err := cn.sendBinaryParameters(b, args)
+ if err != nil {
+ return err
+ }
+ b.bytes(colFmtDataAllText)
+
+ b.next(proto.Describe)
+ b.byte(proto.Parse)
+ b.byte(0) // unnamed portal
+
+ b.next(proto.Execute)
+ b.byte(0)
+ b.int32(0)
+
+ b.next(proto.Sync)
+ return cn.send(b)
+}
+
+func (cn *conn) processParameterStatus(r *readBuf) {
+ switch r.string() {
+ default:
+ // ignore
+ case "server_version":
+ var major1, major2 int
+ _, err := fmt.Sscanf(r.string(), "%d.%d", &major1, &major2)
+ if err == nil {
+ cn.parameterStatus.serverVersion = major1*10000 + major2*100
+ }
+ case "TimeZone":
+ switch tz := r.string(); tz {
+ case "UTC", "Etc/UTC", "Etc/Universal", "Etc/Zulu", "Etc/UCT":
+ cn.parameterStatus.currentLocation = time.UTC
+ default:
+ var err error
+ cn.parameterStatus.currentLocation, err = time.LoadLocation(tz)
+ if err != nil {
+ cn.parameterStatus.currentLocation = nil
+ }
+ }
+ // Use sql.NullBool so we can distinguish between false and not sent. If
+ // it's not sent we use a query to get the value – I don't know when these
+ // parameters are not sent, but this is what libpq does.
+ case "in_hot_standby":
+ b, err := pqutil.ParseBool(r.string())
+ if err == nil {
+ cn.parameterStatus.inHotStandby = sql.NullBool{Valid: true, Bool: b}
+ }
+ case "default_transaction_read_only":
+ b, err := pqutil.ParseBool(r.string())
+ if err == nil {
+ cn.parameterStatus.defaultTransactionReadOnly = sql.NullBool{Valid: true, Bool: b}
+ }
+ }
+}
+
+func (cn *conn) processReadyForQuery(r *readBuf) {
+ cn.txnStatus = transactionStatus(r.byte())
+}
+
+func (cn *conn) readReadyForQuery() error {
+ t, r, err := cn.recv1()
+ if err != nil {
+ return err
+ }
+ switch t {
+ case proto.ReadyForQuery:
+ cn.processReadyForQuery(r)
+ return nil
+ case proto.ErrorResponse:
+ err := parseError(r, "")
+ cn.err.set(driver.ErrBadConn)
+ return err
+ default:
+ cn.err.set(driver.ErrBadConn)
+ return fmt.Errorf("pq: unexpected message %q; expected ReadyForQuery", t)
+ }
+}
+
+func (cn *conn) readParseResponse() error {
+ t, r, err := cn.recv1()
+ if err != nil {
+ return err
+ }
+ switch t {
+ case proto.ParseComplete:
+ return nil
+ case proto.ErrorResponse:
+ err := parseError(r, "")
+ _ = cn.readReadyForQuery()
+ return err
+ default:
+ cn.err.set(driver.ErrBadConn)
+ return fmt.Errorf("pq: unexpected Parse response %q", t)
+ }
+}
+
+func (cn *conn) readStatementDescribeResponse() (paramTyps []oid.Oid, colNames []string, colTyps []fieldDesc, _ error) {
+ for {
+ t, r, err := cn.recv1()
+ if err != nil {
+ return nil, nil, nil, err
+ }
+ switch t {
+ case proto.ParameterDescription:
+ nparams := r.int16()
+ paramTyps = make([]oid.Oid, nparams)
+ for i := range paramTyps {
+ paramTyps[i] = r.oid()
+ }
+ case proto.NoData:
+ return paramTyps, nil, nil, nil
+ case proto.RowDescription:
+ colNames, colTyps = parseStatementRowDescribe(r)
+ return paramTyps, colNames, colTyps, nil
+ case proto.ErrorResponse:
+ err := parseError(r, "")
+ _ = cn.readReadyForQuery()
+ return nil, nil, nil, err
+ default:
+ cn.err.set(driver.ErrBadConn)
+ return nil, nil, nil, fmt.Errorf("pq: unexpected Describe statement response %q", t)
+ }
+ }
+}
+
+func (cn *conn) readPortalDescribeResponse() (rowsHeader, error) {
+ t, r, err := cn.recv1()
+ if err != nil {
+ return rowsHeader{}, err
+ }
+ switch t {
+ case proto.RowDescription:
+ return parsePortalRowDescribe(r), nil
+ case proto.NoData:
+ return rowsHeader{}, nil
+ case proto.ErrorResponse:
+ err := parseError(r, "")
+ _ = cn.readReadyForQuery()
+ return rowsHeader{}, err
+ default:
+ cn.err.set(driver.ErrBadConn)
+ return rowsHeader{}, fmt.Errorf("pq: unexpected Describe response %q", t)
+ }
+}
+
+func (cn *conn) readBindResponse() error {
+ t, r, err := cn.recv1()
+ if err != nil {
+ return err
+ }
+ switch t {
+ case proto.BindComplete:
+ return nil
+ case proto.ErrorResponse:
+ err := parseError(r, "")
+ _ = cn.readReadyForQuery()
+ return err
+ default:
+ cn.err.set(driver.ErrBadConn)
+ return fmt.Errorf("pq: unexpected Bind response %q", t)
+ }
+}
+
+func (cn *conn) postExecuteWorkaround() error {
+ // Work around a bug in sql.DB.QueryRow: in Go 1.2 and earlier it ignores
+ // any errors from rows.Next, which masks errors that happened during the
+ // execution of the query. To avoid the problem in common cases, we wait
+ // here for one more message from the database. If it's not an error the
+ // query will likely succeed (or perhaps has already, if it's a
+ // CommandComplete), so we push the message into the conn struct; recv1
+ // will return it as the next message for rows.Next or rows.Close.
+ // However, if it's an error, we wait until ReadyForQuery and then return
+ // the error to our caller.
+ for {
+ t, r, err := cn.recv1()
+ if err != nil {
+ return err
+ }
+ switch t {
+ case proto.ErrorResponse:
+ err := parseError(r, "")
+ _ = cn.readReadyForQuery()
+ return err
+ case proto.CommandComplete, proto.DataRow, proto.EmptyQueryResponse:
+ // the query didn't fail, but we can't process this message
+ return cn.saveMessage(t, r)
+ default:
+ cn.err.set(driver.ErrBadConn)
+ return fmt.Errorf("pq: unexpected message during extended query execution: %q", t)
+ }
+ }
+}
+
+// Only for Exec(), since we ignore the returned data
+func (cn *conn) readExecuteResponse(protocolState string) (res driver.Result, commandTag string, resErr error) {
+ for {
+ t, r, err := cn.recv1()
+ if err != nil {
+ return nil, "", err
+ }
+ switch t {
+ case proto.CommandComplete:
+ if resErr != nil {
+ cn.err.set(driver.ErrBadConn)
+ return nil, "", fmt.Errorf("pq: unexpected CommandComplete after error %s", resErr)
+ }
+ res, commandTag, err = cn.parseComplete(r.string())
+ if err != nil {
+ return nil, "", err
+ }
+ case proto.ReadyForQuery:
+ cn.processReadyForQuery(r)
+ if res == nil && resErr == nil {
+ resErr = errUnexpectedReady
+ }
+ return res, commandTag, resErr
+ case proto.ErrorResponse:
+ resErr = parseError(r, "")
+ case proto.RowDescription, proto.DataRow, proto.EmptyQueryResponse:
+ if resErr != nil {
+ cn.err.set(driver.ErrBadConn)
+ return nil, "", fmt.Errorf("pq: unexpected %q after error %s", t, resErr)
+ }
+ if t == proto.EmptyQueryResponse {
+ res = emptyRows
+ }
+ // ignore any results
+ default:
+ cn.err.set(driver.ErrBadConn)
+ return nil, "", fmt.Errorf("pq: unknown %s response: %q", protocolState, t)
+ }
+ }
+}
+
+func parseStatementRowDescribe(r *readBuf) (colNames []string, colTyps []fieldDesc) {
+ n := r.int16()
+ colNames = make([]string, n)
+ colTyps = make([]fieldDesc, n)
+ for i := range colNames {
+ colNames[i] = r.string()
+ r.next(6)
+ colTyps[i].OID = r.oid()
+ colTyps[i].Len = r.int16()
+ colTyps[i].Mod = r.int32()
+ // format code not known when describing a statement; always 0
+ r.next(2)
+ }
+ return
+}
+
+func parsePortalRowDescribe(r *readBuf) rowsHeader {
+ n := r.int16()
+ colNames := make([]string, n)
+ colFmts := make([]format, n)
+ colTyps := make([]fieldDesc, n)
+ for i := range colNames {
+ colNames[i] = r.string()
+ r.next(6)
+ colTyps[i].OID = r.oid()
+ colTyps[i].Len = r.int16()
+ colTyps[i].Mod = r.int32()
+ colFmts[i] = format(r.int16())
+ }
+ return rowsHeader{
+ colNames: colNames,
+ colFmts: colFmts,
+ colTyps: colTyps,
+ }
+}
+
+func (cn *conn) ResetSession(ctx context.Context) error {
+ // Ensure bad connections are reported: From database/sql/driver:
+ // If a connection is never returned to the connection pool but immediately reused, then
+ // ResetSession is called prior to reuse but IsValid is not called.
+ return cn.err.get()
+}
+
+func (cn *conn) IsValid() bool {
+ return cn.err.get() == nil
+}
diff --git a/vendor/github.com/lib/pq/conn_go18.go b/vendor/github.com/lib/pq/conn_go18.go
@@ -0,0 +1,226 @@
+package pq
+
+import (
+ "context"
+ "database/sql"
+ "database/sql/driver"
+ "fmt"
+ "io"
+ "time"
+
+ "github.com/lib/pq/internal/proto"
+)
+
+const watchCancelDialContextTimeout = 10 * time.Second
+
+// Implement the "QueryerContext" interface
+func (cn *conn) QueryContext(ctx context.Context, query string, args []driver.NamedValue) (driver.Rows, error) {
+ finish := cn.watchCancel(ctx)
+ r, err := cn.query(query, args)
+ if err != nil {
+ if finish != nil {
+ finish()
+ }
+ return nil, err
+ }
+ r.finish = finish
+ return r, nil
+}
+
+// Implement the "ExecerContext" interface
+func (cn *conn) ExecContext(ctx context.Context, query string, args []driver.NamedValue) (driver.Result, error) {
+ list := make([]driver.Value, len(args))
+ for i, nv := range args {
+ list[i] = nv.Value
+ }
+
+ if finish := cn.watchCancel(ctx); finish != nil {
+ defer finish()
+ }
+
+ return cn.Exec(query, list)
+}
+
+// Implement the "ConnPrepareContext" interface
+func (cn *conn) PrepareContext(ctx context.Context, query string) (driver.Stmt, error) {
+ if finish := cn.watchCancel(ctx); finish != nil {
+ defer finish()
+ }
+ return cn.Prepare(query)
+}
+
+// Implement the "ConnBeginTx" interface
+func (cn *conn) BeginTx(ctx context.Context, opts driver.TxOptions) (driver.Tx, error) {
+ var mode string
+ switch sql.IsolationLevel(opts.Isolation) {
+ case sql.LevelDefault:
+ // Don't touch mode: use the server's default
+ case sql.LevelReadUncommitted:
+ mode = " ISOLATION LEVEL READ UNCOMMITTED"
+ case sql.LevelReadCommitted:
+ mode = " ISOLATION LEVEL READ COMMITTED"
+ case sql.LevelRepeatableRead:
+ mode = " ISOLATION LEVEL REPEATABLE READ"
+ case sql.LevelSerializable:
+ mode = " ISOLATION LEVEL SERIALIZABLE"
+ default:
+ return nil, fmt.Errorf("pq: isolation level not supported: %d", opts.Isolation)
+ }
+ if opts.ReadOnly {
+ mode += " READ ONLY"
+ } else {
+ mode += " READ WRITE"
+ }
+
+ tx, err := cn.begin(mode)
+ if err != nil {
+ return nil, err
+ }
+ cn.txnFinish = cn.watchCancel(ctx)
+ return tx, nil
+}
+
+func (cn *conn) Ping(ctx context.Context) error {
+ if finish := cn.watchCancel(ctx); finish != nil {
+ defer finish()
+ }
+ rows, err := cn.simpleQuery(";")
+ if err != nil {
+ return driver.ErrBadConn
+ }
+ _ = rows.Close()
+ return nil
+}
+
+func (cn *conn) watchCancel(ctx context.Context) func() {
+ if done := ctx.Done(); done != nil {
+ finished := make(chan struct{}, 1)
+ go func() {
+ select {
+ case <-done:
+ select {
+ case finished <- struct{}{}:
+ default:
+ // We raced with the finish func, let the next query handle this with the
+ // context.
+ return
+ }
+
+ // Set the connection state to bad so it does not get reused.
+ cn.err.set(ctx.Err())
+
+ // At this point the function level context is canceled,
+ // so it must not be used for the additional network
+ // request to cancel the query.
+ // Create a new context to pass into the dial.
+ ctxCancel, cancel := context.WithTimeout(context.Background(), watchCancelDialContextTimeout)
+ defer cancel()
+
+ _ = cn.cancel(ctxCancel)
+ case <-finished:
+ }
+ }()
+ return func() {
+ select {
+ case <-finished:
+ cn.err.set(ctx.Err())
+ _ = cn.Close()
+ case finished <- struct{}{}:
+ }
+ }
+ }
+ return nil
+}
+
+func (cn *conn) cancel(ctx context.Context) error {
+ // Use a copy since a new connection is created here. This is necessary
+ // because cancel is called from a goroutine in watchCancel.
+ cfg := cn.cfg.Clone()
+
+ c, err := dial(ctx, cn.dialer, cfg)
+ if err != nil {
+ return err
+ }
+ defer func() { _ = c.Close() }()
+
+ cn2 := conn{c: c}
+ err = cn2.ssl(cfg, cfg.SSLMode)
+ if err != nil {
+ return err
+ }
+
+ w := cn2.writeBuf(0)
+ w.int32(proto.CancelRequestCode)
+ w.int32(cn.pid)
+ w.bytes(cn.secretKey)
+ if err := cn2.sendStartupPacket(w); err != nil {
+ return err
+ }
+
+ // Read until EOF to ensure that the server received the cancel.
+ _, err = io.Copy(io.Discard, c)
+ return err
+}
+
+// Implement the "StmtQueryContext" interface
+func (st *stmt) QueryContext(ctx context.Context, args []driver.NamedValue) (driver.Rows, error) {
+ finish := st.watchCancel(ctx)
+ r, err := st.query(args)
+ if err != nil {
+ if finish != nil {
+ finish()
+ }
+ return nil, err
+ }
+ r.finish = finish
+ return r, nil
+}
+
+// Implement the "StmtExecContext" interface
+func (st *stmt) ExecContext(ctx context.Context, args []driver.NamedValue) (driver.Result, error) {
+ if finish := st.watchCancel(ctx); finish != nil {
+ defer finish()
+ }
+ if err := st.cn.err.get(); err != nil {
+ return nil, err
+ }
+
+ err := st.exec(args)
+ if err != nil {
+ return nil, st.cn.handleError(err)
+ }
+ res, _, err := st.cn.readExecuteResponse("simple query")
+ return res, st.cn.handleError(err)
+}
+
+// watchCancel is implemented on stmt in order to not mark the parent conn as bad
+func (st *stmt) watchCancel(ctx context.Context) func() {
+ if done := ctx.Done(); done != nil {
+ finished := make(chan struct{})
+ go func() {
+ select {
+ case <-done:
+ // At this point the function level context is canceled, so it
+ // must not be used for the additional network request to cancel
+ // the query. Create a new context to pass into the dial.
+ ctxCancel, cancel := context.WithTimeout(context.Background(), watchCancelDialContextTimeout)
+ defer cancel()
+
+ _ = st.cancel(ctxCancel)
+ finished <- struct{}{}
+ case <-finished:
+ }
+ }()
+ return func() {
+ select {
+ case <-finished:
+ case finished <- struct{}{}:
+ }
+ }
+ }
+ return nil
+}
+
+func (st *stmt) cancel(ctx context.Context) error {
+ return st.cn.cancel(ctx)
+}
diff --git a/vendor/github.com/lib/pq/connector.go b/vendor/github.com/lib/pq/connector.go
@@ -0,0 +1,1157 @@
+package pq
+
+import (
+ "context"
+ "crypto/tls"
+ "database/sql/driver"
+ "fmt"
+ "math/rand"
+ "net"
+ "net/netip"
+ neturl "net/url"
+ "os"
+ "path/filepath"
+ "reflect"
+ "slices"
+ "sort"
+ "strconv"
+ "strings"
+ "time"
+ "unicode"
+
+ "github.com/lib/pq/internal/pgservice"
+ "github.com/lib/pq/internal/pqutil"
+ "github.com/lib/pq/internal/proto"
+)
+
+type (
+ // SSLMode is a sslmode setting.
+ SSLMode string
+
+ // SSLNegotiation is a sslnegotiation setting.
+ SSLNegotiation string
+
+ // TargetSessionAttrs is a target_session_attrs setting.
+ TargetSessionAttrs string
+
+ // LoadBalanceHosts is a load_balance_hosts setting.
+ LoadBalanceHosts string
+
+ // ProtocolVersion is a min_protocol_version or max_protocol_version
+ // setting.
+ ProtocolVersion string
+
+ // SSLProtocolVersion is a ssl_min_protocol_version or
+ // ssl_max_protocol_version setting.
+ SSLProtocolVersion string
+)
+
+// Values for [SSLMode] that pq supports.
+const (
+ // No SSL
+ SSLModeDisable = SSLMode("disable")
+
+ // First try a non-SSL connection and if that fails try an SSL connection.
+ SSLModeAllow = SSLMode("allow")
+
+ // First try an SSL connection and if that fails try a non-SSL connection.
+ SSLModePrefer = SSLMode("prefer")
+
+ // Require SSL, but skip verification. This is the default.
+ SSLModeRequire = SSLMode("require")
+
+ // Require SSL and verify that the certificate was signed by a trusted CA.
+ SSLModeVerifyCA = SSLMode("verify-ca")
+
+ // Require SSL and verify that the certificate was signed by a trusted CA
+ // and the server host name matches the one in the certificate.
+ SSLModeVerifyFull = SSLMode("verify-full")
+)
+
+var sslModes = []SSLMode{SSLModeDisable, SSLModeAllow, SSLModePrefer, SSLModeRequire,
+ SSLModeVerifyFull, SSLModeVerifyCA}
+
+func (s SSLMode) useSSL() bool {
+ switch s {
+ case SSLModePrefer, SSLModeRequire, SSLModeVerifyCA, SSLModeVerifyFull:
+ return true
+ }
+ return false
+}
+
+// Values for [SSLNegotiation] that pq supports.
+const (
+ // Negotiate whether SSL should be used. This is the default.
+ SSLNegotiationPostgres = SSLNegotiation("postgres")
+
+ // Always use SSL, don't try to negotiate.
+ SSLNegotiationDirect = SSLNegotiation("direct")
+)
+
+var sslNegotiations = []SSLNegotiation{SSLNegotiationPostgres, SSLNegotiationDirect}
+
+// Values for [TargetSessionAttrs] that pq supports.
+const (
+ // Any successful connection is acceptable. This is the default.
+ TargetSessionAttrsAny = TargetSessionAttrs("any")
+
+ // Session must accept read-write transactions by default: the server must
+ // not be in hot standby mode and default_transaction_read_only must be
+ // off.
+ TargetSessionAttrsReadWrite = TargetSessionAttrs("read-write")
+
+ // Session must not accept read-write transactions by default.
+ TargetSessionAttrsReadOnly = TargetSessionAttrs("read-only")
+
+ // Server must not be in hot standby mode.
+ TargetSessionAttrsPrimary = TargetSessionAttrs("primary")
+
+ // Server must be in hot standby mode.
+ TargetSessionAttrsStandby = TargetSessionAttrs("standby")
+
+ // First try to find a standby server, but if none of the listed hosts is a
+ // standby server, try again in any mode.
+ TargetSessionAttrsPreferStandby = TargetSessionAttrs("prefer-standby")
+)
+
+var targetSessionAttrs = []TargetSessionAttrs{TargetSessionAttrsAny,
+ TargetSessionAttrsReadWrite, TargetSessionAttrsReadOnly, TargetSessionAttrsPrimary,
+ TargetSessionAttrsStandby, TargetSessionAttrsPreferStandby}
+
+// Values for [LoadBalanceHosts] that pq supports.
+const (
+ // Don't load balance; try hosts in the order in which they're provided.
+ // This is the default.
+ LoadBalanceHostsDisable = LoadBalanceHosts("disable")
+
+ // Hosts are tried in random order to balance connections across multiple
+ // PostgreSQL servers.
+ //
+ // When using this value it's recommended to also configure a reasonable
+ // value for connect_timeout. Because then, if one of the nodes that are
+ // used for load balancing is not responding, a new node will be tried.
+ LoadBalanceHostsRandom = LoadBalanceHosts("random")
+)
+
+var loadBalanceHosts = []LoadBalanceHosts{LoadBalanceHostsDisable, LoadBalanceHostsRandom}
+
+// Values for [ProtocolVersion] that pq supports.
+const (
+ // ProtocolVersion30 is the default protocol version, supported in
+ // PostgreSQL 3.0 and newer.
+ ProtocolVersion30 = ProtocolVersion("3.0")
+
+ // ProtocolVersion32 uses a longer secret key length for query cancellation,
+ // supported in PostgreSQL 18 and newer.
+ ProtocolVersion32 = ProtocolVersion("3.2")
+
+ // ProtocolVersionLatest is the latest protocol version that pq supports
+ // (which may not be supported by the server).
+ ProtocolVersionLatest = ProtocolVersion("latest")
+)
+
+var protocolVersions = []ProtocolVersion{ProtocolVersion30, ProtocolVersion32, ProtocolVersionLatest}
+
+// Values for [SSLProtocolVersion] that pq supports.
+const (
+ SSLProtocolVersionTLS10 = SSLProtocolVersion("TLSv1.0")
+ SSLProtocolVersionTLS11 = SSLProtocolVersion("TLSv1.1")
+ SSLProtocolVersionTLS12 = SSLProtocolVersion("TLSv1.2")
+ SSLProtocolVersionTLS13 = SSLProtocolVersion("TLSv1.3")
+)
+
+var sslProtocolVersions = []SSLProtocolVersion{SSLProtocolVersionTLS10, SSLProtocolVersionTLS11,
+ SSLProtocolVersionTLS12, SSLProtocolVersionTLS13}
+
+func (s SSLProtocolVersion) tlsconf() uint16 {
+ switch s {
+ case SSLProtocolVersionTLS10:
+ return tls.VersionTLS10
+ case SSLProtocolVersionTLS11:
+ return tls.VersionTLS11
+ case SSLProtocolVersionTLS12:
+ return tls.VersionTLS12
+ case SSLProtocolVersionTLS13:
+ return tls.VersionTLS13
+ default:
+ return 0
+ }
+}
+
+// Connector represents a fixed configuration for the pq driver with a given
+// dsn. Connector satisfies the [database/sql/driver.Connector] interface and
+// can be used to create any number of DB Conn's via [sql.OpenDB].
+type Connector struct {
+ cfg Config
+ dialer Dialer
+}
+
+// NewConnector returns a connector for the pq driver in a fixed configuration
+// with the given dsn. The returned connector can be used to create any number
+// of equivalent Conn's. The returned connector is intended to be used with
+// [sql.OpenDB].
+func NewConnector(dsn string) (*Connector, error) {
+ cfg, err := NewConfig(dsn)
+ if err != nil {
+ return nil, err
+ }
+ return NewConnectorConfig(cfg)
+}
+
+// NewConnectorConfig returns a connector for the pq driver in a fixed
+// configuration with the given [Config]. The returned connector can be used to
+// create any number of equivalent Conn's. The returned connector is intended to
+// be used with [sql.OpenDB].
+func NewConnectorConfig(cfg Config) (*Connector, error) {
+ return &Connector{cfg: cfg, dialer: defaultDialer{}}, nil
+}
+
+// Connect returns a connection to the database using the fixed configuration of
+// this Connector. Context is not used.
+func (c *Connector) Connect(ctx context.Context) (driver.Conn, error) { return c.open(ctx) }
+
+// Dialer allows change the dialer used to open connections.
+func (c *Connector) Dialer(dialer Dialer) { c.dialer = dialer }
+
+// Driver returns the underlying driver of this Connector.
+func (c *Connector) Driver() driver.Driver { return &Driver{} }
+
+func (p ProtocolVersion) proto() int {
+ switch p {
+ default:
+ return proto.ProtocolVersion30
+ case ProtocolVersion32, ProtocolVersionLatest:
+ return proto.ProtocolVersion32
+ }
+}
+
+// Config holds options pq supports when connecting to PostgreSQL.
+//
+// The postgres struct tag is used for the value from the DSN (e.g.
+// "dbname=abc"), and the env struct tag is used for the environment variable
+// (e.g. "PGDATABASE=abc")
+type Config struct {
+ // The host to connect to. Absolute paths and values that start with @ are
+ // for unix domain sockets. Defaults to localhost.
+ //
+ // A comma-separated list of host names is also accepted, in which case each
+ // host name in the list is tried in order or randomly if load_balance_hosts
+ // is set. An empty item selects the default of localhost. The
+ // target_session_attrs option controls properties the host must have to be
+ // considered acceptable.
+ Host string `postgres:"host" env:"PGHOST"`
+
+ // IPv4 or IPv6 address to connect to. Using hostaddr allows the application
+ // to avoid a host name lookup, which might be important in applications
+ // with time constraints. A hostname is required for sslmode=verify-full and
+ // the GSSAPI or SSPI authentication methods.
+ //
+ // The following rules are used:
+ //
+ // - If host is given without hostaddr, a host name lookup occurs.
+ //
+ // - If hostaddr is given without host, the value for hostaddr gives the
+ // server network address. The connection attempt will fail if the
+ // authentication method requires a host name.
+ //
+ // - If both host and hostaddr are given, the value for hostaddr gives the
+ // server network address. The value for host is ignored unless the
+ // authentication method requires it, in which case it will be used as the
+ // host name.
+ //
+ // A comma-separated list of hostaddr values is also accepted, in which case
+ // each host in the list is tried in order or randonly if load_balance_hosts
+ // is set. An empty item causes the corresponding host name to be used, or
+ // the default host name if that is empty as well. The target_session_attrs
+ // option controls properties the host must have to be considered
+ // acceptable.
+ Hostaddr netip.Addr `postgres:"hostaddr" env:"PGHOSTADDR"`
+
+ // The port to connect to. Defaults to 5432.
+ //
+ // If multiple hosts were given in the host or hostaddr parameters, this
+ // parameter may specify a comma-separated list of ports of the same length
+ // as the host list, or it may specify a single port number to be used for
+ // all hosts. An empty string, or an empty item in a comma-separated list,
+ // specifies the default of 5432.
+ Port uint16 `postgres:"port" env:"PGPORT"`
+
+ // The name of the database to connect to.
+ Database string `postgres:"dbname" env:"PGDATABASE"`
+
+ // The user to sign in as. Defaults to the current user.
+ User string `postgres:"user" env:"PGUSER"`
+
+ // The user's password.
+ Password string `postgres:"password" env:"PGPASSWORD"`
+
+ // Path to [pgpass] file to store passwords; overrides Password.
+ //
+ // [pgpass]: http://www.postgresql.org/docs/current/static/libpq-pgpass.html
+ Passfile string `postgres:"passfile" env:"PGPASSFILE"`
+
+ // Commandline options to send to the server at connection start.
+ Options string `postgres:"options" env:"PGOPTIONS"`
+
+ // Application name, displayed in pg_stat_activity and log entries.
+ ApplicationName string `postgres:"application_name" env:"PGAPPNAME"`
+
+ // Used if application_name is not given. Specifying a fallback name is
+ // useful in generic utility programs that wish to set a default application
+ // name but allow it to be overridden by the user.
+ FallbackApplicationName string `postgres:"fallback_application_name" env:"-"`
+
+ // Whether to use SSL. Defaults to "require" (different from libpq's default
+ // of "prefer").
+ //
+ // [RegisterTLSConfig] can be used to registers a custom [tls.Config], which
+ // can be used by setting sslmode=pqgo-«key» in the connection string.
+ SSLMode SSLMode `postgres:"sslmode" env:"PGSSLMODE"`
+
+ // When set to "direct" it will use SSL without negotiation (PostgreSQL ≥17 only).
+ SSLNegotiation SSLNegotiation `postgres:"sslnegotiation" env:"PGSSLNEGOTIATION"`
+
+ // Path to client SSL certificate. The file must contain PEM encoded data.
+ //
+ // Defaults to ~/.postgresql/postgresql.crt
+ SSLCert string `postgres:"sslcert" env:"PGSSLCERT"`
+
+ // Path to secret key for sslcert. The file must contain PEM encoded data.
+ //
+ // Defaults to ~/.postgresql/postgresql.key
+ SSLKey string `postgres:"sslkey" env:"PGSSLKEY"`
+
+ // Path to root certificate. The file must contain PEM encoded data.
+ //
+ // The special value "system" can be used to load the system's root
+ // certificates ([x509.SystemCertPool]). This will change the default
+ // sslmode to verify-full and issue an error if a lower setting is used – as
+ // anyone can register a valid certificate hostname verification becomes
+ // essential.
+ //
+ // Defaults to ~/.postgresql/root.crt.
+ SSLRootCert string `postgres:"sslrootcert" env:"PGSSLROOTCERT"`
+
+ // By default SNI is on, any value which is not starting with "1" disables
+ // SNI.
+ SSLSNI bool `postgres:"sslsni" env:"PGSSLSNI"`
+
+ // Minimum SSL/TLS protocol version to allow for the connection.
+ //
+ // The default is determined by [tls.Config.MinVersion], which is TLSv1.2 at
+ // the time of writing.
+ SSLMinProtocolVersion SSLProtocolVersion `postgres:"ssl_min_protocol_version" env:"SSLPGMINPROTOCOLVERSION"`
+
+ // Maximum SSL/TLS protocol version to allow for the connection. If not set,
+ // this parameter is ignored and the connection will use the maximum bound
+ // defined by the backend, if set. Setting the maximum protocol version is
+ // mainly useful for testing or if some component has issues working with a
+ // newer protocol.
+ SSLMaxProtocolVersion SSLProtocolVersion `postgres:"ssl_max_protocol_version" env:"SSLPGMAXPROTOCOLVERSION"`
+
+ // Interpert sslcert and sslkey as PEM encoded data, rather than a path to a
+ // PEM file. This is a pq extension, not supported in libpq.
+ SSLInline bool `postgres:"sslinline" env:"-"`
+
+ // GSS (Kerberos) service name when constructing the SPN (default is
+ // postgres). This will be combined with the host to form the full SPN:
+ // krbsrvname/host.
+ KrbSrvname string `postgres:"krbsrvname" env:"PGKRBSRVNAME"`
+
+ // GSS (Kerberos) SPN. This takes priority over krbsrvname if present. This
+ // is a pq extension, not supported in libpq.
+ KrbSpn string `postgres:"krbspn" env:"-"`
+
+ // Maximum time to wait while connecting, in seconds. Zero, negative, or not
+ // specified means wait indefinitely
+ ConnectTimeout time.Duration `postgres:"connect_timeout" env:"PGCONNECT_TIMEOUT"`
+
+ // Whether to always send []byte parameters over as binary. Enables single
+ // round-trip mode for non-prepared Query calls. This is a pq extension, not
+ // supported in libpq.
+ BinaryParameters bool `postgres:"binary_parameters" env:"-"`
+
+ // This connection should never use the binary format when receiving query
+ // results from prepared statements. Only provided for debugging. This is a
+ // pq extension, not supported in libpq.
+ DisablePreparedBinaryResult bool `postgres:"disable_prepared_binary_result" env:"-"`
+
+ // Client encoding; pq only supports UTF8 and this must be blank or "UTF8".
+ ClientEncoding string `postgres:"client_encoding" env:"PGCLIENTENCODING"`
+
+ // Date/time representation to use; pq only supports "ISO, MDY" and this
+ // must be blank or "ISO, MDY".
+ Datestyle string `postgres:"datestyle" env:"PGDATESTYLE"`
+
+ // Default time zone.
+ TZ string `postgres:"tz" env:"PGTZ"`
+
+ // Default mode for the genetic query optimizer.
+ Geqo string `postgres:"geqo" env:"PGGEQO"`
+
+ // Determine whether the session must have certain properties to be
+ // acceptable. It's typically used in combination with multiple host names
+ // to select the first acceptable alternative among several hosts.
+ TargetSessionAttrs TargetSessionAttrs `postgres:"target_session_attrs" env:"PGTARGETSESSIONATTRS"`
+
+ // Controls the order in which the client tries to connect to the available
+ // hosts. Once a connection attempt is successful no other hosts will be
+ // tried. This parameter is typically used in combination with multiple host
+ // names.
+ //
+ // This parameter can be used in combination with target_session_attrs to,
+ // for example, load balance over standby servers only. Once successfully
+ // connected, subsequent queries on the returned connection will all be sent
+ // to the same server.
+ LoadBalanceHosts LoadBalanceHosts `postgres:"load_balance_hosts" env:"PGLOADBALANCEHOSTS"`
+
+ // Minimum acceptable PostgreSQL protocol version. If the server does not
+ // support at least this version, the connection will fail. Defaults to
+ // "3.0".
+ MinProtocolVersion ProtocolVersion `postgres:"min_protocol_version" env:"PGMINPROTOCOLVERSION"`
+
+ // Maximum PostgreSQL protocol version to request from the server. Defaults to "3.0".
+ MaxProtocolVersion ProtocolVersion `postgres:"max_protocol_version" env:"PGMAXPROTOCOLVERSION"`
+
+ // Load connection parameters from the service file at ~/.pg_service.conf
+ // (which can be configured with PGSERVICEFILE).
+ //
+ // The service file is a INI-like file to configure connection parameters:
+ //
+ // [servicename]
+ // # Comment
+ // dbname=foo
+ //
+ // Unlike libpq, this does not look at the system-wide service file, as the
+ // location of this is a compile-time value that is not easy for pq to
+ // retrieve.
+ Service string `postgres:"service" env:"PGSERVICE"`
+
+ // Path to connection service file. Defaults to ~/.pg_service.conf.
+ ServiceFile string `postgres:"-" env:"PGSERVICEFILE"`
+
+ // Runtime parameters: any unrecognized parameter in the DSN will be added
+ // to this and sent to PostgreSQL during startup.
+ Runtime map[string]string `postgres:"-" env:"-"`
+
+ // Multi contains additional connection details. The first value is
+ // available in [Config.Host], [Config.Hostaddr], and [Config.Port], and
+ // additional ones (if any) are available here.
+ Multi []ConfigMultihost
+
+ // Record which parameters were given, so we can distinguish between an
+ // empty string "not given at all".
+ //
+ // The alternative is to use pointers or sql.Null[..], but that's more
+ // awkward to use.
+ set []string `env:"set"`
+
+ multiHost []string
+ multiHostaddr []netip.Addr
+ multiPort []uint16
+}
+
+// ConfigMultihost specifies an additional server to try to connect to.
+type ConfigMultihost struct {
+ Host string
+ Hostaddr netip.Addr
+ Port uint16
+}
+
+// NewConfig creates a new [Config] from the defaults, environment, service
+// file, and DSN, in that order. That is: a service overrides any value from the
+// environment, which in turn gets overridden by the same parameter in the
+// connection string.
+//
+// Most connection parameters supported by PostgreSQL are supported; see the
+// [Config] struct for supported parameters. pq also lets you specify any
+// [run-time parameter] such as search_path or work_mem in the connection
+// string. This is different from libpq, which uses the "options" parameter for
+// this (which also works in pq).
+//
+// # key=value connection strings
+//
+// For key=value strings, use single quotes for values that contain whitespace
+// or empty values. A backslash will escape the next character:
+//
+// "user=pqgo password='with spaces'"
+// "user=''"
+// "user=space\ man password='it\'s valid'"
+//
+// # URL connection strings
+//
+// pq supports URL-style postgres:// or postgresql:// connection strings in the
+// form:
+//
+// postgres[ql]://[user[:pwd]@][net-location][:port][/dbname][?param1=value1&...]
+//
+// Go's [net/url.Parse] is more strict than PostgreSQL's URL parser and will
+// (correctly) reject %2F in the host part. This means that unix-socket URLs:
+//
+// postgres://[user[:pwd]@][unix-socket][:port[/dbname]][?param1=value1&...]
+// postgres://%2Ftmp%2Fpostgres/db
+//
+// will not work. You will need to use "host=/tmp/postgres dbname=db".
+//
+// Similarly, multiple ports also won't work, but ?port= will:
+//
+// postgres://host1,host2:5432,6543/dbname Doesn't work
+// postgres://host1,host2/dbname?port=5432,6543 Works
+//
+// # Environment
+//
+// Most [PostgreSQL environment variables] are supported by pq. Environment
+// variables have a lower precedence than explicitly provided connection
+// parameters. pq will return an error if environment variables it does not
+// support are set. Environment variables have a lower precedence than
+// explicitly provided connection parameters.
+//
+// [PostgreSQL environment variables]: http://www.postgresql.org/docs/current/static/libpq-envars.html
+// [run-time parameter]: http://www.postgresql.org/docs/current/static/runtime-config.html
+func NewConfig(dsn string) (Config, error) {
+ return newConfig(dsn, os.Environ())
+}
+
+// Clone returns a copy of the [Config].
+func (cfg Config) Clone() Config {
+ rt := make(map[string]string)
+ for k, v := range cfg.Runtime {
+ rt[k] = v
+ }
+ c := cfg
+ c.Runtime = rt
+ c.set = append([]string{}, cfg.set...)
+ return c
+}
+
+// hosts returns a slice of copies of this config, one for each host.
+func (cfg Config) hosts() []Config {
+ cfgs := make([]Config, 1, len(cfg.Multi)+1)
+ cfgs[0] = cfg.Clone()
+ for _, m := range cfg.Multi {
+ c := cfg.Clone()
+ c.Host, c.Hostaddr, c.Port = m.Host, m.Hostaddr, m.Port
+ cfgs = append(cfgs, c)
+ }
+
+ if cfg.LoadBalanceHosts == LoadBalanceHostsRandom {
+ rand.Shuffle(len(cfgs), func(i, j int) { cfgs[i], cfgs[j] = cfgs[j], cfgs[i] })
+ }
+
+ return cfgs
+}
+
+func newConfig(dsn string, env []string) (Config, error) {
+ cfg := Config{
+ Host: "localhost",
+ Port: 5432,
+ SSLSNI: true,
+ MinProtocolVersion: "3.0",
+ MaxProtocolVersion: "3.0",
+ }
+ if err := cfg.fromEnv(env); err != nil {
+ return Config{}, err
+ }
+ if err := cfg.fromDSN(dsn); err != nil {
+ return Config{}, err
+ }
+ if err := cfg.fromService(); err != nil {
+ return Config{}, err
+ }
+
+ // Need to have exactly the same number of host and hostaddr, or only specify one.
+ if cfg.isset("host") && cfg.Host != "" && cfg.Hostaddr != (netip.Addr{}) && len(cfg.multiHost) != len(cfg.multiHostaddr) {
+ return Config{}, fmt.Errorf("pq: could not match %d host names to %d hostaddr values",
+ len(cfg.multiHost)+1, len(cfg.multiHostaddr)+1)
+ }
+ // Need one port that applies to all or exactly the same number of ports as hosts.
+ l, ll := max(len(cfg.multiHost), len(cfg.multiHostaddr)), len(cfg.multiPort)
+ if l > 0 && ll > 0 && l != ll {
+ return Config{}, fmt.Errorf("pq: could not match %d port numbers to %d hosts", ll+1, l+1)
+ }
+
+ // Populate Multi
+ if len(cfg.multiHostaddr) > len(cfg.multiHost) {
+ cfg.multiHost = make([]string, len(cfg.multiHostaddr))
+ }
+ for i, h := range cfg.multiHost {
+ p := cfg.Port
+ if len(cfg.multiPort) > 0 {
+ p = cfg.multiPort[i]
+ }
+ var addr netip.Addr
+ if len(cfg.multiHostaddr) > 0 {
+ addr = cfg.multiHostaddr[i]
+ }
+ cfg.Multi = append(cfg.Multi, ConfigMultihost{
+ Host: h,
+ Port: p,
+ Hostaddr: addr,
+ })
+ }
+
+ // Use the "fallback" application name if necessary
+ if cfg.isset("fallback_application_name") && !cfg.isset("application_name") {
+ cfg.ApplicationName = cfg.FallbackApplicationName
+ }
+
+ // We can't work with any client_encoding other than UTF-8 currently.
+ // However, we have historically allowed the user to set it to UTF-8
+ // explicitly, and there's no reason to break such programs, so allow that.
+ // Note that the "options" setting could also set client_encoding, but
+ // parsing its value is not worth it. Instead, we always explicitly send
+ // client_encoding as a separate run-time parameter, which should override
+ // anything set in options.
+ if cfg.isset("client_encoding") && !isUTF8(cfg.ClientEncoding) {
+ return Config{}, fmt.Errorf(`pq: unsupported client_encoding %q: must be absent or "UTF8"`, cfg.ClientEncoding)
+ }
+ // DateStyle needs a similar treatment.
+ if cfg.isset("datestyle") && cfg.Datestyle != "ISO, MDY" {
+ return Config{}, fmt.Errorf(`pq: unsupported datestyle %q: must be absent or "ISO, MDY"`, cfg.Datestyle)
+ }
+ cfg.ClientEncoding, cfg.Datestyle = "UTF8", "ISO, MDY"
+
+ // Set default user if not explicitly provided.
+ if !cfg.isset("user") {
+ u, err := pqutil.User()
+ if err != nil {
+ return Config{}, err
+ }
+ cfg.User = u
+ }
+
+ // SSL is not necessary or supported over UNIX domain sockets.
+ if nw, _ := cfg.network(); nw == "unix" {
+ cfg.SSLMode = SSLModeDisable
+ }
+
+ if cfg.MinProtocolVersion > cfg.MaxProtocolVersion {
+ return Config{}, fmt.Errorf("pq: min_protocol_version %q cannot be greater than max_protocol_version %q",
+ cfg.MinProtocolVersion, cfg.MaxProtocolVersion)
+ }
+ if cfg.SSLNegotiation == SSLNegotiationDirect {
+ switch cfg.SSLMode {
+ case SSLModeDisable, SSLModeAllow, SSLModePrefer:
+ return Config{}, fmt.Errorf(
+ `pq: weak sslmode %q may not be used with sslnegotiation=direct (use "require", "verify-ca", or "verify-full")`,
+ cfg.SSLMode)
+ }
+ }
+ if cfg.SSLRootCert == "system" {
+ if !cfg.isset("sslmode") {
+ cfg.SSLMode = SSLModeVerifyFull
+ }
+ if cfg.SSLMode != SSLModeVerifyFull {
+ return Config{}, fmt.Errorf(
+ `pq: weak sslmode %q may not be used with sslrootcert=system (use "verify-full")`,
+ cfg.SSLMode)
+ }
+ }
+
+ return cfg, nil
+}
+
+func (cfg Config) network() (string, string) {
+ if cfg.Hostaddr != (netip.Addr{}) {
+ return "tcp", net.JoinHostPort(cfg.Hostaddr.String(), strconv.Itoa(int(cfg.Port)))
+ }
+ // UNIX domain sockets are either represented by an (absolute) file system
+ // path or they live in the abstract name space (starting with an @).
+ if filepath.IsAbs(cfg.Host) || strings.HasPrefix(cfg.Host, "@") {
+ sockPath := filepath.Join(cfg.Host, ".s.PGSQL."+strconv.Itoa(int(cfg.Port)))
+ return "unix", sockPath
+ }
+ return "tcp", net.JoinHostPort(cfg.Host, strconv.Itoa(int(cfg.Port)))
+}
+
+func (cfg *Config) fromEnv(env []string) error {
+ e := make(map[string]string)
+ for _, v := range env {
+ k, v, ok := strings.Cut(v, "=")
+ if !ok {
+ continue
+ }
+ switch k {
+ case "PGREQUIRESSL", "PGSSLCOMPRESSION", // Deprecated.
+ "PGREALM", "PGGSSENCMODE", "PGGSSDELEGATION", "PGGSSLIB", // krb stuff
+ "PGREQUIREAUTH", "PGCHANNELBINDING",
+ "PGSSLCERTMODE", "PGSSLCRL", "PGSSLCRLDIR", "PGREQUIREPEER":
+ return fmt.Errorf("pq: environment variable $%s is not supported", k)
+ case "PGKRBSRVNAME":
+ if newGss == nil {
+ return fmt.Errorf("pq: environment variable $%s is not supported as Kerberos is not enabled", k)
+ }
+ }
+ e[k] = v
+ }
+ return cfg.setFromTag(e, "env", false)
+}
+
+// fromDSN parses the options from name and adds them to the values.
+//
+// The parsing code is based on conninfo_parse from libpq's fe-connect.c
+func (cfg *Config) fromDSN(dsn string) error {
+ if strings.HasPrefix(dsn, "postgres://") || strings.HasPrefix(dsn, "postgresql://") {
+ var err error
+ dsn, err = convertURL(dsn)
+ if err != nil {
+ return err
+ }
+ }
+
+ var (
+ opt = make(map[string]string)
+ s = []rune(dsn)
+ i int
+ next = func() (rune, bool) {
+ if i >= len(s) {
+ return 0, false
+ }
+ r := s[i]
+ i++
+ return r, true
+ }
+ skipSpaces = func() (rune, bool) {
+ r, ok := next()
+ for unicode.IsSpace(r) && ok {
+ r, ok = next()
+ }
+ return r, ok
+ }
+ )
+
+ for {
+ var (
+ keyRunes, valRunes []rune
+ r rune
+ ok bool
+ )
+
+ if r, ok = skipSpaces(); !ok {
+ break
+ }
+
+ // Scan the key
+ for !unicode.IsSpace(r) && r != '=' {
+ keyRunes = append(keyRunes, r)
+ if r, ok = next(); !ok {
+ break
+ }
+ }
+
+ // Skip any whitespace if we're not at the = yet
+ if r != '=' {
+ r, ok = skipSpaces()
+ }
+
+ // The current character should be =
+ if r != '=' || !ok {
+ return fmt.Errorf(`missing "=" after %q in connection info string`, string(keyRunes))
+ }
+
+ // Skip any whitespace after the =
+ if r, ok = skipSpaces(); !ok {
+ // If we reach the end here, the last value is just an empty string as per libpq.
+ opt[string(keyRunes)] = ""
+ break
+ }
+
+ if r != '\'' {
+ for !unicode.IsSpace(r) {
+ if r == '\\' {
+ if r, ok = next(); !ok {
+ return fmt.Errorf(`missing character after backslash`)
+ }
+ }
+ valRunes = append(valRunes, r)
+
+ if r, ok = next(); !ok {
+ break
+ }
+ }
+ } else {
+ quote:
+ for {
+ if r, ok = next(); !ok {
+ return fmt.Errorf(`unterminated quoted string literal in connection string`)
+ }
+ switch r {
+ case '\'':
+ break quote
+ case '\\':
+ r, _ = next()
+ fallthrough
+ default:
+ valRunes = append(valRunes, r)
+ }
+ }
+ }
+
+ opt[string(keyRunes)] = string(valRunes)
+ }
+
+ return cfg.setFromTag(opt, "postgres", false)
+}
+
+func (cfg *Config) fromService() error {
+ if cfg.Service == "" {
+ return nil
+ }
+
+ if !cfg.isset("PGSERVICEFILE") {
+ if home := pqutil.Home(false); home != "" {
+ cfg.ServiceFile = filepath.Join(home, ".pg_service.conf")
+ }
+ }
+
+ opts, err := pgservice.FindService(cfg.ServiceFile, cfg.Service)
+ if err != nil {
+ return fmt.Errorf("pq: %w", err)
+ }
+ return cfg.setFromTag(opts, "postgres", true)
+}
+
+func (cfg *Config) setFromTag(o map[string]string, tag string, service bool) error {
+ f := "pq: wrong value for %q: "
+ if tag == "env" {
+ f = "pq: wrong value for $%s: "
+ }
+ var (
+ types = reflect.TypeOf(cfg).Elem()
+ values = reflect.ValueOf(cfg).Elem()
+ )
+ for i := 0; i < types.NumField(); i++ {
+ var (
+ rt = types.Field(i)
+ rv = values.Field(i)
+ k = rt.Tag.Get(tag)
+ connectTimeout = (tag == "postgres" && k == "connect_timeout") || (tag == "env" && k == "PGCONNECT_TIMEOUT")
+ host = (tag == "postgres" && k == "host") || (tag == "env" && k == "PGHOST")
+ hostaddr = (tag == "postgres" && k == "hostaddr") || (tag == "env" && k == "PGHOSTADDR")
+ port = (tag == "postgres" && k == "port") || (tag == "env" && k == "PGPORT")
+ sslmode = (tag == "postgres" && k == "sslmode") || (tag == "env" && k == "PGSSLMODE")
+ sslnegotiation = (tag == "postgres" && k == "sslnegotiation") || (tag == "env" && k == "PGSSLNEGOTIATION")
+ targetsessionattrs = (tag == "postgres" && k == "target_session_attrs") || (tag == "env" && k == "PGTARGETSESSIONATTRS")
+ loadbalancehosts = (tag == "postgres" && k == "load_balance_hosts") || (tag == "env" && k == "PGLOADBALANCEHOSTS")
+ minprotocolversion = (tag == "postgres" && k == "min_protocol_version") || (tag == "env" && k == "PGMINPROTOCOLVERSION")
+ maxprotocolversion = (tag == "postgres" && k == "max_protocol_version") || (tag == "env" && k == "PGMAXPROTOCOLVERSION")
+ sslminprotocolversion = (tag == "postgres" && k == "ssl_min_protocol_version") || (tag == "env" && k == "SSLPGMINPROTOCOLVERSION")
+ sslmaxprotocolversion = (tag == "postgres" && k == "ssl_max_protocol_version") || (tag == "env" && k == "SSLPGMAXPROTOCOLVERSION")
+ )
+ if k == "" || k == "-" {
+ continue
+ }
+
+ v, ok := o[k]
+ delete(o, k)
+ if ok {
+ t, ok := rt.Tag.Lookup("postgres")
+ if !ok || t == "" || t == "-" { // For PGSERVICEFILE, which can only be from env
+ t, ok = rt.Tag.Lookup("env")
+ }
+ if ok && t != "" && t != "-" {
+ cfg.set = append(cfg.set, t)
+ }
+ switch rt.Type.Kind() {
+ default:
+ return fmt.Errorf("don't know how to set %s: unknown type %s", rt.Name, rt.Type.Kind())
+ case reflect.Struct:
+ if rt.Type == reflect.TypeOf(netip.Addr{}) {
+ if hostaddr {
+ vv := strings.Split(v, ",")
+ v = vv[0]
+ for _, vvv := range vv[1:] {
+ if vvv == "" {
+ cfg.multiHostaddr = append(cfg.multiHostaddr, netip.Addr{})
+ } else {
+ ip, err := netip.ParseAddr(vvv)
+ if err != nil {
+ return fmt.Errorf(f+"%w", k, err)
+ }
+ cfg.multiHostaddr = append(cfg.multiHostaddr, ip)
+ }
+ }
+ }
+ ip, err := netip.ParseAddr(v)
+ if err != nil {
+ return fmt.Errorf(f+"%w", k, err)
+ }
+ rv.Set(reflect.ValueOf(ip))
+ } else {
+ return fmt.Errorf("don't know how to set %s: unknown type %s", rt.Name, rt.Type)
+ }
+ case reflect.String:
+ if sslmode && !slices.Contains(sslModes, SSLMode(v)) && !(strings.HasPrefix(v, "pqgo-") && hasTLSConfig(v[5:])) {
+ return fmt.Errorf(f+`%q is not supported; supported values are %s`, k, v, pqutil.Join(sslModes))
+ }
+ if sslnegotiation && !slices.Contains(sslNegotiations, SSLNegotiation(v)) {
+ return fmt.Errorf(f+`%q is not supported; supported values are %s`, k, v, pqutil.Join(sslNegotiations))
+ }
+ if targetsessionattrs && !slices.Contains(targetSessionAttrs, TargetSessionAttrs(v)) {
+ return fmt.Errorf(f+`%q is not supported; supported values are %s`, k, v, pqutil.Join(targetSessionAttrs))
+ }
+ if loadbalancehosts && !slices.Contains(loadBalanceHosts, LoadBalanceHosts(v)) {
+ return fmt.Errorf(f+`%q is not supported; supported values are %s`, k, v, pqutil.Join(loadBalanceHosts))
+ }
+ if (minprotocolversion || maxprotocolversion) && !slices.Contains(protocolVersions, ProtocolVersion(v)) {
+ return fmt.Errorf(f+`%q is not supported; supported values are %s`, k, v, pqutil.Join(protocolVersions))
+ }
+ if (sslminprotocolversion || sslmaxprotocolversion) && !slices.Contains(sslProtocolVersions, SSLProtocolVersion(v)) {
+ return fmt.Errorf(f+`%q is not supported; supported values are %s`, k, v, pqutil.Join(sslProtocolVersions))
+ }
+ if host {
+ vv := strings.Split(v, ",")
+ v = vv[0]
+ for i, vvv := range vv[1:] {
+ if vvv == "" {
+ vv[i+1] = "localhost"
+ }
+ }
+ cfg.multiHost = append(cfg.multiHost, vv[1:]...)
+ }
+ rv.SetString(v)
+ case reflect.Int64:
+ n, err := strconv.ParseInt(v, 10, 64)
+ if err != nil {
+ return fmt.Errorf(f+"%w", k, err)
+ }
+ if connectTimeout {
+ n = int64(time.Duration(n) * time.Second)
+ }
+ rv.SetInt(n)
+ case reflect.Uint16:
+ if port {
+ vv := strings.Split(v, ",")
+ v = vv[0]
+ for _, vvv := range vv[1:] {
+ if vvv == "" {
+ vvv = "5432"
+ }
+ n, err := strconv.ParseUint(vvv, 10, 16)
+ if err != nil {
+ return fmt.Errorf(f+"%w", k, err)
+ }
+ cfg.multiPort = append(cfg.multiPort, uint16(n))
+ }
+ }
+ n, err := strconv.ParseUint(v, 10, 16)
+ if err != nil {
+ return fmt.Errorf(f+"%w", k, err)
+ }
+ rv.SetUint(n)
+ case reflect.Bool:
+ b, err := pqutil.ParseBool(v)
+ if err != nil {
+ return fmt.Errorf(f+"%w", k, err)
+ }
+ rv.SetBool(b)
+ }
+ }
+ }
+
+ if service && len(o) > 0 {
+ // TODO(go1.23): use maps.Keys once we require Go 1.23.
+ var key string
+ for k := range o {
+ key = k
+ break
+ }
+ return fmt.Errorf("pq: unknown setting %q in service file for service %q", key, cfg.Service)
+ }
+
+ // Set run-time; we delete map keys as they're set in the struct.
+ if !service && tag == "postgres" {
+ // Make sure database= sets dbname=, as that previously worked (kind of
+ // by accident).
+ // TODO(v2): remove
+ if d, ok := o["database"]; ok {
+ cfg.Database = d
+ delete(o, "database")
+ }
+ cfg.Runtime = o
+ }
+
+ return nil
+}
+
+// Should generally only be used from newConfig(), as it will never be set if
+// people go outside that.
+func (cfg Config) isset(name string) bool {
+ return slices.Contains(cfg.set, name)
+}
+
+// Convert to a map; used only in tests.
+func (cfg Config) tomap() map[string]string {
+ var (
+ o = make(map[string]string)
+ values = reflect.ValueOf(cfg)
+ types = reflect.TypeOf(cfg)
+ )
+ for i := 0; i < types.NumField(); i++ {
+ var (
+ rt = types.Field(i)
+ rv = values.Field(i)
+ k = rt.Tag.Get("postgres")
+ )
+ if k == "" || k == "-" {
+ continue
+ }
+ if !rv.IsZero() || slices.Contains(cfg.set, k) {
+ switch rt.Type.Kind() {
+ default:
+ if s, ok := rv.Interface().(fmt.Stringer); ok {
+ o[k] = s.String()
+ } else {
+ o[k] = rv.String()
+ }
+ case reflect.Uint16:
+ n := rv.Uint()
+ o[k] = strconv.FormatUint(n, 10)
+ case reflect.Int64:
+ n := rv.Int()
+ if k == "connect_timeout" {
+ n = int64(time.Duration(n) / time.Second)
+ }
+ o[k] = strconv.FormatInt(n, 10)
+ case reflect.Bool:
+ if rv.Bool() {
+ o[k] = "yes"
+ } else {
+ o[k] = "no"
+ }
+ }
+ }
+ }
+ for k, v := range cfg.Runtime {
+ o[k] = v
+ }
+ return o
+}
+
+// Create DSN for this config; used only in tests.
+func (cfg Config) string() string {
+ var (
+ m = cfg.tomap()
+ keys = make([]string, 0, len(m))
+ )
+ for k := range m {
+ switch k {
+ case "datestyle", "client_encoding":
+ continue
+ case "host", "port", "user", "sslsni", "min_protocol_version", "max_protocol_version":
+ if !cfg.isset(k) {
+ continue
+ }
+ }
+ if k == "application_name" && m[k] == "pqgo" {
+ continue
+ }
+ if k == "host" && len(cfg.multiHost) > 0 {
+ m[k] += "," + strings.Join(cfg.multiHost, ",")
+ }
+ if k == "hostaddr" && len(cfg.multiHostaddr) > 0 {
+ for _, ha := range cfg.multiHostaddr {
+ m[k] += ","
+ if ha != (netip.Addr{}) {
+ m[k] += ha.String()
+ }
+ }
+ }
+ if k == "port" && len(cfg.multiPort) > 0 {
+ for _, p := range cfg.multiPort {
+ m[k] += "," + strconv.Itoa(int(p))
+ }
+ }
+ keys = append(keys, k)
+ }
+ sort.Strings(keys)
+
+ var b strings.Builder
+ for i, k := range keys {
+ if i > 0 {
+ b.WriteByte(' ')
+ }
+ b.WriteString(k)
+ b.WriteByte('=')
+ var (
+ v = m[k]
+ nv = make([]rune, 0, len(v)+2)
+ quote = v == ""
+ )
+ for _, c := range v {
+ if c == ' ' {
+ quote = true
+ }
+ if c == '\'' {
+ nv = append(nv, '\\')
+ }
+ nv = append(nv, c)
+ }
+ if quote {
+ b.WriteByte('\'')
+ }
+ b.WriteString(string(nv))
+ if quote {
+ b.WriteByte('\'')
+ }
+ }
+ return b.String()
+}
+
+// Recognize all sorts of silly things as "UTF-8", like Postgres does
+func isUTF8(name string) bool {
+ s := strings.Map(func(c rune) rune {
+ if 'A' <= c && c <= 'Z' {
+ return c + ('a' - 'A')
+ }
+ if 'a' <= c && c <= 'z' || '0' <= c && c <= '9' {
+ return c
+ }
+ return -1 // discard
+ }, name)
+ return s == "utf8" || s == "unicode"
+}
+
+func convertURL(url string) (string, error) {
+ u, err := neturl.Parse(url)
+ if err != nil {
+ return "", err
+ }
+
+ if u.Scheme != "postgres" && u.Scheme != "postgresql" {
+ return "", fmt.Errorf("invalid connection protocol: %s", u.Scheme)
+ }
+
+ var kvs []string
+ escaper := strings.NewReplacer(`'`, `\'`, `\`, `\\`)
+ accrue := func(k, v string) {
+ if v != "" {
+ kvs = append(kvs, k+"='"+escaper.Replace(v)+"'")
+ }
+ }
+
+ if u.User != nil {
+ pw, _ := u.User.Password()
+ accrue("user", u.User.Username())
+ accrue("password", pw)
+ }
+
+ if host, port, err := net.SplitHostPort(u.Host); err != nil {
+ accrue("host", u.Host)
+ } else {
+ accrue("host", host)
+ accrue("port", port)
+ }
+
+ if u.Path != "" {
+ accrue("dbname", u.Path[1:])
+ }
+
+ q := u.Query()
+ for k := range q {
+ accrue(k, q.Get(k))
+ }
+
+ sort.Strings(kvs) // Makes testing easier (not a performance concern)
+ return strings.Join(kvs, " "), nil
+}
diff --git a/vendor/github.com/lib/pq/copy.go b/vendor/github.com/lib/pq/copy.go
@@ -0,0 +1,339 @@
+package pq
+
+import (
+ "context"
+ "database/sql/driver"
+ "encoding/binary"
+ "errors"
+ "fmt"
+ "os"
+ "sync"
+
+ "github.com/lib/pq/internal/proto"
+)
+
+var (
+ errCopyInClosed = errors.New("pq: copyin statement has already been closed")
+ errBinaryCopyNotSupported = errors.New("pq: only text format supported for COPY")
+ errCopyToNotSupported = errors.New("pq: COPY TO is not supported")
+ errCopyNotSupportedOutsideTxn = errors.New("pq: COPY is only allowed inside a transaction")
+)
+
+type copyin struct {
+ cn *conn
+ buffer []byte
+ rowData chan []byte
+ done chan bool
+ closed bool
+ mu struct {
+ sync.Mutex
+ err error
+ driver.Result
+ }
+}
+
+const (
+ ciBufferSize = 64 * 1024
+ // flush buffer before the buffer is filled up and needs reallocation
+ ciBufferFlushSize = 63 * 1024
+)
+
+func (cn *conn) prepareCopyIn(q string) (_ driver.Stmt, resErr error) {
+ if !cn.isInTransaction() {
+ return nil, errCopyNotSupportedOutsideTxn
+ }
+
+ ci := ©in{
+ cn: cn,
+ buffer: make([]byte, 0, ciBufferSize),
+ rowData: make(chan []byte),
+ done: make(chan bool, 1),
+ }
+ // add CopyData identifier + 4 bytes for message length
+ ci.buffer = append(ci.buffer, byte(proto.CopyDataRequest), 0, 0, 0, 0)
+
+ b := cn.writeBuf(proto.Query)
+ b.string(q)
+ err := cn.send(b)
+ if err != nil {
+ return nil, err
+ }
+
+awaitCopyInResponse:
+ for {
+ t, r, err := cn.recv1()
+ if err != nil {
+ return nil, err
+ }
+ switch t {
+ case proto.CopyInResponse:
+ if r.byte() != 0 {
+ resErr = errBinaryCopyNotSupported
+ break awaitCopyInResponse
+ }
+ go ci.resploop()
+ return ci, nil
+ case proto.CopyOutResponse:
+ resErr = errCopyToNotSupported
+ break awaitCopyInResponse
+ case proto.ErrorResponse:
+ resErr = parseError(r, q)
+ case proto.ReadyForQuery:
+ if resErr == nil {
+ ci.setBad(driver.ErrBadConn)
+ return nil, fmt.Errorf("pq: unexpected ReadyForQuery in response to COPY")
+ }
+ cn.processReadyForQuery(r)
+ return nil, resErr
+ default:
+ ci.setBad(driver.ErrBadConn)
+ return nil, fmt.Errorf("pq: unknown response for copy query: %q", t)
+ }
+ }
+
+ // something went wrong, abort COPY before we return
+ b = cn.writeBuf(proto.CopyFail)
+ b.string(resErr.Error())
+ err = cn.send(b)
+ if err != nil {
+ return nil, err
+ }
+
+ for {
+ t, r, err := cn.recv1()
+ if err != nil {
+ return nil, err
+ }
+
+ switch t {
+ case proto.CopyDoneResponse, proto.CommandComplete, proto.ErrorResponse:
+ case proto.ReadyForQuery:
+ // correctly aborted, we're done
+ cn.processReadyForQuery(r)
+ return nil, resErr
+ default:
+ ci.setBad(driver.ErrBadConn)
+ return nil, fmt.Errorf("pq: unknown response for CopyFail: %q", t)
+ }
+ }
+}
+
+func (ci *copyin) flush(buf []byte) error {
+ if len(buf)-1 > proto.MaxUint32 {
+ return errors.New("pq: too many columns")
+ }
+ if debugProto {
+ fmt.Fprintf(os.Stderr, "CLIENT → %-20s %5d %q\n", proto.RequestCode(buf[0]), len(buf)-5, buf[5:])
+ }
+ binary.BigEndian.PutUint32(buf[1:], uint32(len(buf)-1)) // Set message length (without message identifier).
+ _, err := ci.cn.c.Write(buf)
+ return err
+}
+
+func (ci *copyin) resploop() {
+ for {
+ var r readBuf
+ t, err := ci.cn.recvMessage(&r)
+ if err != nil {
+ ci.setBad(driver.ErrBadConn)
+ ci.setError(err)
+ ci.done <- true
+ return
+ }
+ switch t {
+ case proto.CommandComplete:
+ // complete
+ res, _, err := ci.cn.parseComplete(r.string())
+ if err != nil {
+ panic(err)
+ }
+ ci.setResult(res)
+ case proto.NoticeResponse:
+ if n := ci.cn.noticeHandler; n != nil {
+ n(parseError(&r, ""))
+ }
+ case proto.ReadyForQuery:
+ ci.cn.processReadyForQuery(&r)
+ ci.done <- true
+ return
+ case proto.ErrorResponse:
+ err := parseError(&r, "")
+ ci.setError(err)
+ default:
+ ci.setBad(driver.ErrBadConn)
+ ci.setError(fmt.Errorf("unknown response during CopyIn: %q", t))
+ ci.done <- true
+ return
+ }
+ }
+}
+
+func (ci *copyin) setBad(err error) {
+ ci.cn.err.set(err)
+}
+
+func (ci *copyin) getBad() error {
+ return ci.cn.err.get()
+}
+
+func (ci *copyin) err() error {
+ ci.mu.Lock()
+ err := ci.mu.err
+ ci.mu.Unlock()
+ return err
+}
+
+// setError() sets ci.err if one has not been set already. Caller must not be
+// holding ci.Mutex.
+func (ci *copyin) setError(err error) {
+ ci.mu.Lock()
+ if ci.mu.err == nil {
+ ci.mu.err = err
+ }
+ ci.mu.Unlock()
+}
+
+func (ci *copyin) setResult(result driver.Result) {
+ ci.mu.Lock()
+ ci.mu.Result = result
+ ci.mu.Unlock()
+}
+
+func (ci *copyin) getResult() driver.Result {
+ ci.mu.Lock()
+ result := ci.mu.Result
+ ci.mu.Unlock()
+ if result == nil {
+ return driver.RowsAffected(0)
+ }
+ return result
+}
+
+func (ci *copyin) NumInput() int {
+ return -1
+}
+
+func (ci *copyin) Query(v []driver.Value) (r driver.Rows, err error) {
+ return nil, ErrNotSupported
+}
+
+// Exec inserts values into the COPY stream. The insert is asynchronous
+// and Exec can return errors from previous Exec calls to the same
+// COPY stmt.
+//
+// You need to call Exec(nil) to sync the COPY stream and to get any
+// errors from pending data, since Stmt.Close() doesn't return errors
+// to the user.
+func (ci *copyin) Exec(v []driver.Value) (driver.Result, error) {
+ if ci.closed {
+ return nil, errCopyInClosed
+ }
+ if err := ci.getBad(); err != nil {
+ return nil, err
+ }
+ if err := ci.err(); err != nil {
+ return nil, err
+ }
+
+ if len(v) == 0 {
+ if err := ci.Close(); err != nil {
+ return driver.RowsAffected(0), err
+ }
+ return ci.getResult(), nil
+ }
+
+ var (
+ numValues = len(v)
+ err error
+ )
+ for i, value := range v {
+ ci.buffer, err = appendEncodedText(ci.buffer, value)
+ if err != nil {
+ return nil, ci.cn.handleError(err)
+ }
+ if i < numValues-1 {
+ ci.buffer = append(ci.buffer, '\t')
+ }
+ }
+
+ ci.buffer = append(ci.buffer, '\n')
+
+ if len(ci.buffer) > ciBufferFlushSize {
+ err := ci.flush(ci.buffer)
+ if err != nil {
+ return nil, ci.cn.handleError(err)
+ }
+ // reset buffer, keep bytes for message identifier and length
+ ci.buffer = ci.buffer[:5]
+ }
+
+ return driver.RowsAffected(0), nil
+}
+
+// CopyData inserts a raw string into the COPY stream. The insert is
+// asynchronous and CopyData can return errors from previous CopyData calls to
+// the same COPY stmt.
+//
+// You need to call Exec(nil) to sync the COPY stream and to get any
+// errors from pending data, since Stmt.Close() doesn't return errors
+// to the user.
+func (ci *copyin) CopyData(ctx context.Context, line string) (driver.Result, error) {
+ if ci.closed {
+ return nil, errCopyInClosed
+ }
+ if finish := ci.cn.watchCancel(ctx); finish != nil {
+ defer finish()
+ }
+ if err := ci.getBad(); err != nil {
+ return nil, err
+ }
+ if err := ci.err(); err != nil {
+ return nil, err
+ }
+
+ ci.buffer = append(ci.buffer, []byte(line)...)
+ ci.buffer = append(ci.buffer, '\n')
+
+ if len(ci.buffer) > ciBufferFlushSize {
+ err := ci.flush(ci.buffer)
+ if err != nil {
+ return nil, ci.cn.handleError(err)
+ }
+
+ // reset buffer, keep bytes for message identifier and length
+ ci.buffer = ci.buffer[:5]
+ }
+
+ return driver.RowsAffected(0), nil
+}
+
+func (ci *copyin) Close() error {
+ if ci.closed { // Don't do anything, we're already closed
+ return nil
+ }
+ ci.closed = true
+
+ if err := ci.getBad(); err != nil {
+ return err
+ }
+
+ if len(ci.buffer) > 0 {
+ err := ci.flush(ci.buffer)
+ if err != nil {
+ return ci.cn.handleError(err)
+ }
+ }
+ // Avoid touching the scratch buffer as resploop could be using it.
+ err := ci.cn.sendSimpleMessage(proto.CopyDoneRequest)
+ if err != nil {
+ return ci.cn.handleError(err)
+ }
+
+ <-ci.done
+ ci.cn.inProgress.Store(false)
+
+ if err := ci.err(); err != nil {
+ return err
+ }
+ return nil
+}
diff --git a/vendor/github.com/lib/pq/deprecated.go b/vendor/github.com/lib/pq/deprecated.go
@@ -0,0 +1,133 @@
+package pq
+
+import (
+ "bytes"
+ "database/sql"
+
+ "github.com/lib/pq/pqerror"
+)
+
+// [pq.Error.Severity] values.
+//
+// Deprecated: use pqerror.Severity[..] values.
+//
+//go:fix inline
+const (
+ Efatal = pqerror.SeverityFatal
+ Epanic = pqerror.SeverityPanic
+ Ewarning = pqerror.SeverityWarning
+ Enotice = pqerror.SeverityNotice
+ Edebug = pqerror.SeverityDebug
+ Einfo = pqerror.SeverityInfo
+ Elog = pqerror.SeverityLog
+)
+
+// PGError is an interface used by previous versions of pq.
+//
+// Deprecated: use the Error type. This is never used.
+type PGError interface {
+ Error() string
+ Fatal() bool
+ Get(k byte) (v string)
+}
+
+// Get implements the legacy PGError interface.
+//
+// Deprecated: new code should use the fields of the Error struct directly.
+func (e *Error) Get(k byte) (v string) {
+ switch k {
+ case 'S':
+ return e.Severity
+ case 'C':
+ return string(e.Code)
+ case 'M':
+ return e.Message
+ case 'D':
+ return e.Detail
+ case 'H':
+ return e.Hint
+ case 'P':
+ return e.Position
+ case 'p':
+ return e.InternalPosition
+ case 'q':
+ return e.InternalQuery
+ case 'W':
+ return e.Where
+ case 's':
+ return e.Schema
+ case 't':
+ return e.Table
+ case 'c':
+ return e.Column
+ case 'd':
+ return e.DataTypeName
+ case 'n':
+ return e.Constraint
+ case 'F':
+ return e.File
+ case 'L':
+ return e.Line
+ case 'R':
+ return e.Routine
+ }
+ return ""
+}
+
+// ParseURL converts a url to a connection string for driver.Open.
+//
+// Deprecated: directly passing an URL to sql.Open("postgres", "postgres://...")
+// now works, and calling this manually is no longer required.
+func ParseURL(url string) (string, error) { return convertURL(url) }
+
+// NullTime represents a [time.Time] that may be null.
+//
+// Deprecated: this is an alias for [sql.NullTime].
+//
+//go:fix inline
+type NullTime = sql.NullTime
+
+// CopyIn creates a COPY FROM statement which can be prepared with Tx.Prepare().
+// The target table should be visible in search_path.
+//
+// It copies all columns if the list of columns is empty.
+//
+// Deprecated: there is no need to use this query builder, you can use:
+//
+// tx.Prepare("copy tbl (col1, col2) from stdin")
+func CopyIn(table string, columns ...string) string {
+ b := bytes.NewBufferString("COPY ")
+ BufferQuoteIdentifier(table, b)
+ makeStmt(b, columns...)
+ return b.String()
+}
+
+// CopyInSchema creates a COPY FROM statement which can be prepared with
+// Tx.Prepare().
+//
+// Deprecated: there is no need to use this query builder, you can use:
+//
+// tx.Prepare("copy schema.tbl (col1, col2) from stdin")
+func CopyInSchema(schema, table string, columns ...string) string {
+ b := bytes.NewBufferString("COPY ")
+ BufferQuoteIdentifier(schema, b)
+ b.WriteRune('.')
+ BufferQuoteIdentifier(table, b)
+ makeStmt(b, columns...)
+ return b.String()
+}
+
+func makeStmt(b *bytes.Buffer, columns ...string) {
+ if len(columns) == 0 {
+ b.WriteString(" FROM STDIN")
+ return
+ }
+ b.WriteString(" (")
+ for i, col := range columns {
+ if i != 0 {
+ b.WriteString(", ")
+ }
+ BufferQuoteIdentifier(col, b)
+ }
+ b.WriteString(") FROM STDIN")
+}
diff --git a/vendor/github.com/lib/pq/doc.go b/vendor/github.com/lib/pq/doc.go
@@ -0,0 +1,137 @@
+/*
+Package pq is a Go PostgreSQL driver for database/sql.
+
+Most clients will use the database/sql package instead of using this package
+directly. For example:
+
+ import (
+ "database/sql"
+
+ _ "github.com/lib/pq"
+ )
+
+ func main() {
+ dsn := "user=pqgo dbname=pqgo sslmode=verify-full"
+ db, err := sql.Open("postgres", dsn)
+ if err != nil {
+ log.Fatal(err)
+ }
+
+ age := 21
+ rows, err := db.Query("select name from users where age = $1", age)
+ // …
+ }
+
+You can also connect with an URL:
+
+ dsn := "postgres://pqgo:password@localhost/pqgo?sslmode=verify-full"
+ db, err := sql.Open("postgres", dsn)
+
+# Connection String Parameters
+
+See [NewConfig].
+
+# Queries
+
+database/sql does not dictate any specific format for parameter placeholders,
+and pq uses the PostgreSQL-native ordinal markers ($1, $2, etc.). The same
+placeholder can be used more than once:
+
+ rows, err := db.Query(
+ `select * from users where name = $1 or age between $2 and $2 + 3`,
+ "Duck", 64)
+
+pq does not support [sql.Result.LastInsertId]. Use the RETURNING clause with a
+Query or QueryRow call instead to return the identifier:
+
+ row := db.QueryRow(`insert into users(name, age) values('Scrooge McDuck', 93) returning id`)
+
+ var userid int
+ err := row.Scan(&userid)
+
+# Data Types
+
+Parameters pass through [driver.DefaultParameterConverter] before they are handled
+by this package. When the binary_parameters connection option is enabled, []byte
+values are sent directly to the backend as data in binary format.
+
+This package returns the following types for values from the PostgreSQL backend:
+
+ - integer types smallint, integer, and bigint are returned as int64
+ - floating-point types real and double precision are returned as float64
+ - character types char, varchar, and text are returned as string
+ - temporal types date, time, timetz, timestamp, and timestamptz are
+ returned as time.Time
+ - the boolean type is returned as bool
+ - the bytea type is returned as []byte
+
+All other types are returned directly from the backend as []byte values in text format.
+
+# Errors
+
+pq may return errors of type [*pq.Error] which contain error details:
+
+ pqErr := new(pq.Error)
+ if errors.As(err, &pqErr) {
+ fmt.Println("pq error:", pqErr.Code.Name())
+ }
+
+# Bulk imports
+
+You can perform bulk imports by preparing a "COPY [..] FROM STDIN" statement in
+a transaction ([sql.Tx]). The returned [sql.Stmt] handle can then be repeatedly
+"executed" to copy data into the target table. After all data has been processed
+you should call Exec() once with no arguments to flush all buffered data. Any
+call to Exec() might return an error which should be handled appropriately, but
+because of the internal buffering an error returned by Exec() might not be
+related to the data passed in the call that failed.
+
+It is not possible to COPY outside of an explicit transaction in pq.
+
+Use nil for NULL, or explicitly add WITH NULL 'SOME STRING' (the default of \N
+doesn't work).
+
+# Notifications
+
+PostgreSQL supports a simple publish/subscribe model using PostgreSQL's [NOTIFY] mechanism.
+
+To start listening for notifications, you first have to open a new connection to
+the database by calling [NewListener]. This connection can not be used for
+anything other than LISTEN / NOTIFY. Calling Listen will open a "notification
+channel"; once a notification channel is open, a notification generated on that
+channel will effect a send on the Listener.Notify channel. A notification
+channel will remain open until Unlisten is called, though connection loss might
+result in some notifications being lost. To solve this problem, Listener sends a
+nil pointer over the Notify channel any time the connection is re-established
+following a connection loss. The application can get information about the state
+of the underlying connection by setting an event callback in the call to
+NewListener.
+
+A single [Listener] can safely be used from concurrent goroutines, which means
+that there is often no need to create more than one Listener in your
+application. However, a Listener is always connected to a single database, so
+you will need to create a new Listener instance for every database you want to
+receive notifications in.
+
+The channel name in both Listen and Unlisten is case sensitive, and can contain
+any characters legal in an [identifier]. Note that the channel name will be
+truncated to 63 bytes by the PostgreSQL server.
+
+# Kerberos Support
+
+If you need support for Kerberos authentication, add the following to your main
+package:
+
+ import "github.com/lib/pq/auth/kerberos"
+
+ func init() {
+ pq.RegisterGSSProvider(func() (pq.Gss, error) { return kerberos.NewGSS() })
+ }
+
+This package is in a separate module so that users who don't need Kerberos don't
+have to add unnecessary dependencies.
+
+[identifier]: http://www.postgresql.org/docs/current/static/sql-syntax-lexical.html#SQL-SYNTAX-IDENTIFIERS
+[NOTIFY]: http://www.postgresql.org/docs/current/static/sql-notify.html
+*/
+package pq
diff --git a/vendor/github.com/lib/pq/encode.go b/vendor/github.com/lib/pq/encode.go
@@ -0,0 +1,400 @@
+package pq
+
+import (
+ "bytes"
+ "encoding/binary"
+ "encoding/hex"
+ "errors"
+ "fmt"
+ "strconv"
+ "strings"
+ "time"
+
+ "github.com/lib/pq/internal/pqtime"
+ "github.com/lib/pq/oid"
+)
+
+func binaryEncode(x any) ([]byte, error) {
+ switch v := x.(type) {
+ case []byte:
+ return v, nil
+ default:
+ return encode(x, oid.T_unknown)
+ }
+}
+
+func encode(x any, pgtypOid oid.Oid) ([]byte, error) {
+ switch v := x.(type) {
+ case int64:
+ return strconv.AppendInt(nil, v, 10), nil
+ case float64:
+ return strconv.AppendFloat(nil, v, 'f', -1, 64), nil
+ case []byte:
+ if v == nil {
+ return nil, nil
+ }
+ if pgtypOid == oid.T_bytea {
+ return encodeBytea(v), nil
+ }
+ return v, nil
+ case string:
+ if pgtypOid == oid.T_bytea {
+ return encodeBytea([]byte(v)), nil
+ }
+ return []byte(v), nil
+ case bool:
+ return strconv.AppendBool(nil, v), nil
+ case time.Time:
+ return formatTS(v), nil
+ default:
+ return nil, fmt.Errorf("pq: encode: unknown type for %T", v)
+ }
+}
+
+func decode(ps *parameterStatus, s []byte, typ oid.Oid, f format) (any, error) {
+ switch f {
+ case formatBinary:
+ return binaryDecode(s, typ)
+ case formatText:
+ return textDecode(ps, s, typ)
+ default:
+ panic("unreachable")
+ }
+}
+
+func binaryDecode(s []byte, typ oid.Oid) (any, error) {
+ switch typ {
+ case oid.T_bytea:
+ return s, nil
+ case oid.T_int8:
+ return int64(binary.BigEndian.Uint64(s)), nil
+ case oid.T_int4:
+ return int64(int32(binary.BigEndian.Uint32(s))), nil
+ case oid.T_int2:
+ return int64(int16(binary.BigEndian.Uint16(s))), nil
+ case oid.T_uuid:
+ return decodeUUIDBinary(s)
+ default:
+ return nil, fmt.Errorf("pq: don't know how to decode binary parameter of type %d", uint32(typ))
+ }
+
+}
+
+// decodeUUIDBinary interprets the binary format of a uuid, returning it in text format.
+func decodeUUIDBinary(src []byte) ([]byte, error) {
+ if len(src) != 16 {
+ return nil, fmt.Errorf("pq: unable to decode uuid; bad length: %d", len(src))
+ }
+
+ dst := make([]byte, 36)
+ dst[8], dst[13], dst[18], dst[23] = '-', '-', '-', '-'
+ hex.Encode(dst[0:], src[0:4])
+ hex.Encode(dst[9:], src[4:6])
+ hex.Encode(dst[14:], src[6:8])
+ hex.Encode(dst[19:], src[8:10])
+ hex.Encode(dst[24:], src[10:16])
+ return dst, nil
+}
+
+func textDecode(ps *parameterStatus, s []byte, typ oid.Oid) (any, error) {
+ switch typ {
+ case oid.T_char, oid.T_bpchar, oid.T_varchar, oid.T_text:
+ return string(s), nil
+ case oid.T_bytea:
+ b, err := parseBytea(s)
+ if err != nil {
+ err = errors.New("pq: " + err.Error())
+ }
+ return b, err
+ case oid.T_timestamptz:
+ return parseTS(ps.currentLocation, string(s))
+ case oid.T_timestamp, oid.T_date:
+ return parseTS(nil, string(s))
+ case oid.T_time:
+ return parseTime(typ, s)
+ case oid.T_timetz:
+ return parseTime(typ, s)
+ case oid.T_bool:
+ return s[0] == 't', nil
+ case oid.T_int8, oid.T_int4, oid.T_int2:
+ i, err := strconv.ParseInt(string(s), 10, 64)
+ if err != nil {
+ err = errors.New("pq: " + err.Error())
+ }
+ return i, err
+ case oid.T_float4, oid.T_float8:
+ // We always use 64 bit parsing, regardless of whether the input text is for
+ // a float4 or float8, because clients expect float64s for all float datatypes
+ // and returning a 32-bit parsed float64 produces lossy results.
+ f, err := strconv.ParseFloat(string(s), 64)
+ if err != nil {
+ err = errors.New("pq: " + err.Error())
+ }
+ return f, err
+ }
+ return s, nil
+}
+
+// appendEncodedText encodes item in text format as required by COPY
+// and appends to buf
+func appendEncodedText(buf []byte, x any) ([]byte, error) {
+ switch v := x.(type) {
+ case int64:
+ return strconv.AppendInt(buf, v, 10), nil
+ case float64:
+ return strconv.AppendFloat(buf, v, 'f', -1, 64), nil
+ case []byte:
+ encodedBytea := encodeBytea(v)
+ return appendEscapedText(buf, string(encodedBytea)), nil
+ case string:
+ return appendEscapedText(buf, v), nil
+ case bool:
+ return strconv.AppendBool(buf, v), nil
+ case time.Time:
+ return append(buf, formatTS(v)...), nil
+ case nil:
+ return append(buf, `\N`...), nil
+ default:
+ return nil, fmt.Errorf("pq: encode: unknown type for %T", v)
+ }
+}
+
+func appendEscapedText(buf []byte, text string) []byte {
+ escapeNeeded := false
+ startPos := 0
+
+ // check if we need to escape
+ for i := 0; i < len(text); i++ {
+ c := text[i]
+ if c == '\\' || c == '\n' || c == '\r' || c == '\t' {
+ escapeNeeded = true
+ startPos = i
+ break
+ }
+ }
+ if !escapeNeeded {
+ return append(buf, text...)
+ }
+
+ // copy till first char to escape, iterate the rest
+ result := append(buf, text[:startPos]...)
+ for i := startPos; i < len(text); i++ {
+ switch c := text[i]; c {
+ case '\\':
+ result = append(result, '\\', '\\')
+ case '\n':
+ result = append(result, '\\', 'n')
+ case '\r':
+ result = append(result, '\\', 'r')
+ case '\t':
+ result = append(result, '\\', 't')
+ default:
+ result = append(result, c)
+ }
+ }
+ return result
+}
+
+func parseTime(typ oid.Oid, s []byte) (time.Time, error) {
+ str := string(s)
+
+ f := "15:04:05"
+ if typ == oid.T_timetz {
+ f = "15:04:05-07"
+ // PostgreSQL just sends the hour if the minute and second is 0:
+ // 22:04:59+00
+ // 22:04:59+08
+ // 22:04:59+08:30
+ // 22:04:59+08:30:40
+ // 23:00:00.112321+02:12:13
+ // So add those to the format string.
+ c := strings.Count(str, ":")
+ if c > 3 {
+ f = "15:04:05-07:00:00"
+ } else if c > 2 {
+ f = "15:04:05-07:00"
+ }
+ }
+
+ // Go doesn't parse 24:00, so manually set that to midnight on Jan 2. 24:00
+ // is never with subseconds but may have a timezone:
+ // 24:00:00
+ // 24:00:00+08
+ // 24:00:00-08:01:01
+ var is2400Time bool
+ if strings.HasPrefix(str, "24:00:00") {
+ is2400Time = true
+ if len(str) > 8 {
+ str = "00:00:00" + str[8:]
+ } else {
+ str = "00:00:00"
+ }
+ }
+
+ t, err := time.Parse(f, str)
+ if err != nil {
+ return time.Time{}, errors.New("pq: " + err.Error())
+ }
+ if is2400Time {
+ t = t.Add(24 * time.Hour)
+ }
+ // TODO(v2): it uses UTC, which it shouldn't. But I'm afraid changing it now
+ // will break people's code.
+ //if typ == oid.T_time {
+ // // Don't use UTC but time.FixedZone("", 0)
+ // t = t.In(globalLocationCache.getLocation(0))
+ //}
+ return t, nil
+}
+
+var (
+ infinityTSEnabled = false
+ infinityTSNegative time.Time
+ infinityTSPositive time.Time
+)
+
+// EnableInfinityTs controls the handling of Postgres' "-infinity" and
+// "infinity" "timestamp"s.
+//
+// If EnableInfinityTs is not called, "-infinity" and "infinity" will return
+// []byte("-infinity") and []byte("infinity") respectively, and potentially
+// cause error "sql: Scan error on column index 0: unsupported driver -> Scan
+// pair: []uint8 -> *time.Time", when scanning into a time.Time value.
+//
+// Once EnableInfinityTs has been called, all connections created using this
+// driver will decode Postgres' "-infinity" and "infinity" for "timestamp",
+// "timestamp with time zone" and "date" types to the predefined minimum and
+// maximum times, respectively. When encoding time.Time values, any time which
+// equals or precedes the predefined minimum time will be encoded to
+// "-infinity". Any values at or past the maximum time will similarly be
+// encoded to "infinity".
+//
+// If EnableInfinityTs is called with negative >= positive, it will panic.
+// Calling EnableInfinityTs after a connection has been established results in
+// undefined behavior. If EnableInfinityTs is called more than once, it will
+// panic.
+func EnableInfinityTs(negative time.Time, positive time.Time) {
+ if infinityTSEnabled {
+ panic("pq: infinity timestamp already enabled")
+ }
+ if !negative.Before(positive) {
+ panic("pq: infinity timestamp: negative value must be smaller (before) than positive")
+ }
+ infinityTSEnabled = true
+ infinityTSNegative = negative
+ infinityTSPositive = positive
+}
+
+// Testing might want to toggle infinityTSEnabled
+func disableInfinityTS() {
+ infinityTSEnabled = false
+}
+
+// This is a time function specific to the Postgres default DateStyle setting
+// ("ISO, MDY"), the only one we currently support. This accounts for the
+// discrepancies between the parsing available with time.Parse and the Postgres
+// date formatting quirks.
+func parseTS(currentLocation *time.Location, str string) (any, error) {
+ switch str {
+ case "-infinity":
+ if infinityTSEnabled {
+ return infinityTSNegative, nil
+ }
+ return []byte(str), nil
+ case "infinity":
+ if infinityTSEnabled {
+ return infinityTSPositive, nil
+ }
+ return []byte(str), nil
+ }
+ t, err := ParseTimestamp(currentLocation, str)
+ if err != nil {
+ err = errors.New("pq: " + err.Error())
+ }
+ return t, err
+}
+
+// ParseTimestamp parses Postgres' text format. It returns a time.Time in
+// currentLocation iff that time's offset agrees with the offset sent from the
+// Postgres server. Otherwise, ParseTimestamp returns a time.Time with the fixed
+// offset offset provided by the Postgres server.
+func ParseTimestamp(currentLocation *time.Location, str string) (time.Time, error) {
+ return pqtime.Parse(currentLocation, str)
+}
+
+// formatTS formats t into a format postgres understands.
+func formatTS(t time.Time) []byte {
+ if infinityTSEnabled {
+ // t <= -infinity : ! (t > -infinity)
+ if !t.After(infinityTSNegative) {
+ return []byte("-infinity")
+ }
+ // t >= infinity : ! (!t < infinity)
+ if !t.Before(infinityTSPositive) {
+ return []byte("infinity")
+ }
+ }
+ return FormatTimestamp(t)
+}
+
+// FormatTimestamp formats t into Postgres' text format for timestamps.
+func FormatTimestamp(t time.Time) []byte {
+ return pqtime.Format(t)
+}
+
+// Parse a bytea value received from the server. Both "hex" and the legacy
+// "escape" format are supported.
+func parseBytea(s []byte) (result []byte, err error) {
+ // Hex format.
+ if len(s) >= 2 && bytes.Equal(s[:2], []byte("\\x")) {
+ s = s[2:] // trim off leading "\\x"
+ result = make([]byte, hex.DecodedLen(len(s)))
+ _, err := hex.Decode(result, s)
+ if err != nil {
+ return nil, err
+ }
+ return result, nil
+ }
+
+ // Escape format.
+ for len(s) > 0 {
+ if s[0] == '\\' {
+ // escaped '\\'
+ if len(s) >= 2 && s[1] == '\\' {
+ result = append(result, '\\')
+ s = s[2:]
+ continue
+ }
+
+ // '\\' followed by an octal number
+ if len(s) < 4 {
+ return nil, fmt.Errorf("invalid bytea sequence %v", s)
+ }
+ r, err := strconv.ParseUint(string(s[1:4]), 8, 8)
+ if err != nil {
+ return nil, fmt.Errorf("could not parse bytea value: %w", err)
+ }
+ result = append(result, byte(r))
+ s = s[4:]
+ } else {
+ // We hit an unescaped, raw byte. Try to read in as many as
+ // possible in one go.
+ i := bytes.IndexByte(s, '\\')
+ if i == -1 {
+ result = append(result, s...)
+ break
+ }
+ result = append(result, s[:i]...)
+ s = s[i:]
+ }
+ }
+ return result, nil
+}
+
+func encodeBytea(v []byte) (result []byte) {
+ result = make([]byte, 2+hex.EncodedLen(len(v)))
+ result[0] = '\\'
+ result[1] = 'x'
+ hex.Encode(result[2:], v)
+ return result
+}
diff --git a/vendor/github.com/lib/pq/error.go b/vendor/github.com/lib/pq/error.go
@@ -0,0 +1,324 @@
+package pq
+
+import (
+ "database/sql/driver"
+ "fmt"
+ "io"
+ "net"
+ "runtime"
+ "strconv"
+ "strings"
+ "unicode/utf8"
+
+ "github.com/lib/pq/pqerror"
+)
+
+// Error returned by the PostgreSQL server.
+//
+// The [Error] method returns the error message and error code:
+//
+// pq: invalid input syntax for type json (22P02)
+//
+// The [ErrorWithDetail] method also includes the error Detail, Hint, and
+// location context (if any):
+//
+// ERROR: invalid input syntax for type json (22P02)
+// DETAIL: Token "asd" is invalid.
+// CONTEXT: line 5, column 8:
+//
+// 3 | 'def',
+// 4 | 123,
+// 5 | 'foo', 'asd'::jsonb
+// ^
+type Error struct {
+ // [Efatal], [Epanic], [Ewarning], [Enotice], [Edebug], [Einfo], or [Elog].
+ // Always present.
+ Severity string
+
+ // SQLSTATE code. Always present.
+ Code pqerror.Code
+
+ // Primary human-readable error message. This should be accurate but terse
+ // (typically one line). Always present.
+ Message string
+
+ // Optional secondary error message carrying more detail about the problem.
+ // Might run to multiple lines.
+ Detail string
+
+ // Optional suggestion what to do about the problem. This is intended to
+ // differ from Detail in that it offers advice (potentially inappropriate)
+ // rather than hard facts. Might run to multiple lines.
+ Hint string
+
+ // error position as an index into the original query string, as decimal
+ // ASCII integer. The first character has index 1, and positions are
+ // measured in characters not bytes.
+ Position string
+
+ // This is defined the same as the Position field, but it is used when the
+ // cursor position refers to an internally generated command rather than the
+ // one submitted by the client. The InternalQuery field will always appear
+ // when this field appears.
+ InternalPosition string
+
+ // Text of a failed internally-generated command. This could be, for
+ // example, an SQL query issued by a PL/pgSQL function.
+ InternalQuery string
+
+ // An indication of the context in which the error occurred. Presently this
+ // includes a call stack traceback of active procedural language functions
+ // and internally-generated queries. The trace is one entry per line, most
+ // recent first.
+ Where string
+
+ // If the error was associated with a specific database object, the name of
+ // the schema containing that object, if any.
+ Schema string
+
+ // If the error was associated with a specific table, the name of the table.
+ // (Refer to the schema name field for the name of the table's schema.)
+ Table string
+
+ // If the error was associated with a specific table column, the name of the
+ // column. (Refer to the schema and table name fields to identify the
+ // table.)
+ Column string
+
+ // If the error was associated with a specific data type, the name of the
+ // data type. (Refer to the schema name field for the name of the data
+ // type's schema.)
+ DataTypeName string
+
+ // If the error was associated with a specific constraint, the name of the
+ // constraint. Refer to fields listed above for the associated table or
+ // domain. (For this purpose, indexes are treated as constraints, even if
+ // they weren't created with constraint syntax.)
+ Constraint string
+
+ // File name of the source-code location where the error was reported.
+ File string
+
+ // Line number of the source-code location where the error was reported.
+ Line string
+
+ // Name of the source-code routine reporting the error.
+ Routine string
+
+ query string
+}
+
+type (
+ // ErrorCode is a five-character error code.
+ //
+ // Deprecated: use pqerror.Code
+ //
+ //go:fix inline
+ ErrorCode = pqerror.Code
+
+ // ErrorClass is only the class part of an error code.
+ //
+ // Deprecated: use pqerror.Class
+ //
+ //go:fix inline
+ ErrorClass = pqerror.Class
+)
+
+func parseError(r *readBuf, q string) *Error {
+ err := &Error{query: q}
+ for t := r.byte(); t != 0; t = r.byte() {
+ msg := r.string()
+ switch t {
+ case 'S':
+ err.Severity = msg
+ case 'C':
+ err.Code = pqerror.Code(msg)
+ case 'M':
+ err.Message = msg
+ case 'D':
+ err.Detail = msg
+ case 'H':
+ err.Hint = msg
+ case 'P':
+ err.Position = msg
+ case 'p':
+ err.InternalPosition = msg
+ case 'q':
+ err.InternalQuery = msg
+ case 'W':
+ err.Where = msg
+ case 's':
+ err.Schema = msg
+ case 't':
+ err.Table = msg
+ case 'c':
+ err.Column = msg
+ case 'd':
+ err.DataTypeName = msg
+ case 'n':
+ err.Constraint = msg
+ case 'F':
+ err.File = msg
+ case 'L':
+ err.Line = msg
+ case 'R':
+ err.Routine = msg
+ }
+ }
+ return err
+}
+
+// Fatal returns true if the Error Severity is fatal.
+func (e *Error) Fatal() bool { return e.Severity == pqerror.SeverityFatal }
+
+// SQLState returns the SQLState of the error.
+func (e *Error) SQLState() string { return string(e.Code) }
+
+func (e *Error) Error() string {
+ msg := e.Message
+ if e.query != "" && e.Position != "" {
+ pos, err := strconv.Atoi(e.Position)
+ if err == nil {
+ lines := strings.Split(e.query, "\n")
+ line, col := posToLine(pos, lines)
+ if len(lines) == 1 {
+ msg += " at column " + strconv.Itoa(col)
+ } else {
+ msg += " at position " + strconv.Itoa(line) + ":" + strconv.Itoa(col)
+ }
+ }
+ }
+
+ if e.Code != "" {
+ return "pq: " + msg + " (" + string(e.Code) + ")"
+ }
+ return "pq: " + msg
+}
+
+// ErrorWithDetail returns the error message with detailed information and
+// location context (if any).
+//
+// See the documentation on [Error].
+func (e *Error) ErrorWithDetail() string {
+ b := new(strings.Builder)
+ b.Grow(len(e.Message) + len(e.Detail) + len(e.Hint) + 30)
+ b.WriteString("ERROR: ")
+ b.WriteString(e.Message)
+ if e.Code != "" {
+ b.WriteString(" (")
+ b.WriteString(string(e.Code))
+ b.WriteByte(')')
+ }
+ if e.Detail != "" {
+ b.WriteString("\nDETAIL: ")
+ b.WriteString(e.Detail)
+ }
+ if e.Hint != "" {
+ b.WriteString("\nHINT: ")
+ b.WriteString(e.Hint)
+ }
+
+ if e.query != "" && e.Position != "" {
+ b.Grow(512)
+ pos, err := strconv.Atoi(e.Position)
+ if err != nil {
+ return b.String()
+ }
+ lines := strings.Split(e.query, "\n")
+ line, col := posToLine(pos, lines)
+
+ fmt.Fprintf(b, "\nCONTEXT: line %d, column %d:\n\n", line, col)
+ if line > 2 {
+ fmt.Fprintf(b, "% 7d | %s\n", line-2, expandTab(lines[line-3]))
+ }
+ if line > 1 {
+ fmt.Fprintf(b, "% 7d | %s\n", line-1, expandTab(lines[line-2]))
+ }
+ /// Expand tabs, so that the ^ is at at the correct position, but leave
+ /// "column 10-13" intact. Adjusting this to the visual column would be
+ /// better, but we don't know the tabsize of the user in their editor,
+ /// which can be 8, 4, 2, or something else. We can't know. So leaving
+ /// it as the character index is probably the "most correct".
+ expanded := expandTab(lines[line-1])
+ diff := len(expanded) - len(lines[line-1])
+ fmt.Fprintf(b, "% 7d | %s\n", line, expanded)
+ fmt.Fprintf(b, "% 10s%s%s\n", "", strings.Repeat(" ", col-1+diff), "^")
+ }
+
+ return b.String()
+}
+
+func posToLine(pos int, lines []string) (line, col int) {
+ read := 0
+ for i := range lines {
+ line++
+ ll := utf8.RuneCountInString(lines[i]) + 1 // +1 for the removed newline
+ if read+ll >= pos {
+ col = max(pos-read, 1) // Should be lower than 1, but just in case.
+ break
+ }
+ read += ll
+ }
+ return line, col
+}
+
+func expandTab(s string) string {
+ var (
+ b strings.Builder
+ l int
+ fill = func(n int) string {
+ b := make([]byte, n)
+ for i := range b {
+ b[i] = ' '
+ }
+ return string(b)
+ }
+ )
+ b.Grow(len(s))
+ for _, r := range s {
+ switch r {
+ case '\t':
+ tw := 8 - l%8
+ b.WriteString(fill(tw))
+ l += tw
+ default:
+ b.WriteRune(r)
+ l += 1
+ }
+ }
+ return b.String()
+}
+
+func (cn *conn) handleError(reported error, query ...string) error {
+ switch err := reported.(type) {
+ case nil:
+ return nil
+ case runtime.Error, *net.OpError:
+ cn.err.set(driver.ErrBadConn)
+ case *safeRetryError:
+ cn.err.set(driver.ErrBadConn)
+ reported = driver.ErrBadConn
+ case *Error:
+ if len(query) > 0 && query[0] != "" {
+ err.query = query[0]
+ reported = err
+ }
+ if err.Fatal() {
+ reported = driver.ErrBadConn
+ }
+ case error:
+ if err == io.EOF || err == io.ErrUnexpectedEOF || err.Error() == "remote error: handshake failure" {
+ reported = driver.ErrBadConn
+ }
+ default:
+ cn.err.set(driver.ErrBadConn)
+ reported = fmt.Errorf("pq: unknown error %T: %[1]s", err)
+ }
+
+ // Any time we return ErrBadConn, we need to remember it since *Tx doesn't
+ // mark the connection bad in database/sql.
+ if reported == driver.ErrBadConn {
+ cn.err.set(driver.ErrBadConn)
+ }
+ return reported
+}
diff --git a/vendor/github.com/lib/pq/internal/pgpass/pgpass.go b/vendor/github.com/lib/pq/internal/pgpass/pgpass.go
@@ -0,0 +1,70 @@
+package pgpass
+
+import (
+ "bufio"
+ "os"
+ "path/filepath"
+ "strings"
+
+ "github.com/lib/pq/internal/pqutil"
+)
+
+func PasswordFromPgpass(passfile, user, password, host, port, dbname string) string {
+ if password != "" { // Do not process .pgpass if a password was supplied.
+ return password
+ }
+
+ filename := pqutil.Pgpass(passfile)
+ if filename == "" {
+ return ""
+ }
+
+ fp, err := os.Open(filename)
+ if err != nil {
+ return ""
+ }
+ defer fp.Close()
+
+ scan := bufio.NewScanner(fp)
+ for scan.Scan() {
+ line := scan.Text()
+ if len(line) == 0 || line[0] == '#' {
+ continue
+ }
+ split := splitFields(line)
+ if len(split) != 5 {
+ continue
+ }
+
+ socket := host == "" || filepath.IsAbs(host) || strings.HasPrefix(host, "@")
+ if (split[0] == "*" || split[0] == host || (split[0] == "localhost" && socket)) &&
+ (split[1] == "*" || split[1] == port) &&
+ (split[2] == "*" || split[2] == dbname) &&
+ (split[3] == "*" || split[3] == user) {
+ return split[4]
+ }
+ }
+
+ return ""
+}
+
+func splitFields(s string) []string {
+ var (
+ fs = make([]string, 0, 5)
+ f = make([]rune, 0, len(s))
+ esc bool
+ )
+ for _, c := range s {
+ switch {
+ case esc:
+ f, esc = append(f, c), false
+ case c == '\\':
+ esc = true
+ case c == ':':
+ fs, f = append(fs, string(f)), f[:0]
+ default:
+ f = append(f, c)
+ }
+ }
+ return append(fs, string(f))
+}
diff --git a/vendor/github.com/lib/pq/internal/pgservice/pgservice.go b/vendor/github.com/lib/pq/internal/pgservice/pgservice.go
@@ -0,0 +1,70 @@
+package pgservice
+
+import (
+ "bufio"
+ "fmt"
+ "os"
+ "strings"
+
+ "github.com/lib/pq/internal/pqutil"
+)
+
+func FindService(path string, service string) (map[string]string, error) {
+ fp, err := os.Open(path)
+ if err != nil {
+ if pqutil.ErrNotExists(err) {
+ // libpq just returns "definition of service not found" if the
+ // default file doesn't exist, but IMO that's confusing.
+ return nil, fmt.Errorf("service file %q not found", path)
+ }
+ return nil, err
+ }
+ defer fp.Close()
+
+ var (
+ scan = bufio.NewScanner(fp)
+ i int
+ )
+ for scan.Scan() {
+ i++
+ line := strings.TrimSpace(scan.Text())
+ if line == "" || line[0] == '#' {
+ continue
+ }
+
+ // [service] header that we want.
+ if line[0] == '[' && line[len(line)-1] == ']' && strings.TrimSpace(line[1:len(line)-1]) == service {
+ opts := make(map[string]string)
+ for scan.Scan() {
+ i++
+ line := strings.TrimSpace(scan.Text())
+ if line == "" || line[0] == '#' {
+ continue
+ }
+ // Next header: our work here is done.
+ if line[0] == '[' && line[len(line)-1] == ']' {
+ return opts, nil
+ }
+
+ k, v, ok := strings.Cut(line, "=")
+ if !ok {
+ return nil, fmt.Errorf("line %d: missing '=' in %q", i, line)
+ }
+ k, v = strings.TrimSpace(k), strings.TrimSpace(v)
+ if k == "" {
+ return nil, fmt.Errorf("line %d: no value before '=' in %q", i, line)
+ }
+ opts[k] = v
+ }
+ if scan.Err() != nil {
+ return nil, scan.Err()
+ }
+ return opts, nil
+ }
+ }
+ if scan.Err() != nil {
+ return nil, scan.Err()
+ }
+
+ return nil, fmt.Errorf("definition of service %q not found", service)
+}
diff --git a/vendor/github.com/lib/pq/internal/pqsql/copy.go b/vendor/github.com/lib/pq/internal/pqsql/copy.go
@@ -0,0 +1,37 @@
+package pqsql
+
+// StartsWithCopy reports if the SQL strings start with "copy", ignoring
+// whitespace, comments, and casing.
+func StartsWithCopy(query string) bool {
+ if len(query) < 4 {
+ return false
+ }
+ var linecmt, blockcmt bool
+ for i := 0; i < len(query); i++ {
+ c := query[i]
+ if linecmt {
+ linecmt = c != '\n'
+ continue
+ }
+ if blockcmt {
+ blockcmt = !(c == '/' && query[i-1] == '*')
+ continue
+ }
+ if c == '-' && len(query) > i+1 && query[i+1] == '-' {
+ linecmt = true
+ continue
+ }
+ if c == '/' && len(query) > i+1 && query[i+1] == '*' {
+ blockcmt = true
+ continue
+ }
+ if c == ' ' || c == '\t' || c == '\r' || c == '\n' {
+ continue
+ }
+
+ // First non-comment and non-whitespace.
+ return len(query) > i+3 && c|0x20 == 'c' && query[i+1]|0x20 == 'o' &&
+ query[i+2]|0x20 == 'p' && query[i+3]|0x20 == 'y'
+ }
+ return false
+}
diff --git a/vendor/github.com/lib/pq/internal/pqtime/loc.go b/vendor/github.com/lib/pq/internal/pqtime/loc.go
@@ -0,0 +1,37 @@
+package pqtime
+
+import (
+ "sync"
+ "time"
+)
+
+// The location cache caches the time zones typically used by the client.
+type locationCache struct {
+ cache map[int]*time.Location
+ lock sync.Mutex
+}
+
+// All connections share the same list of timezones. Benchmarking shows that
+// about 5% speed could be gained by putting the cache in the connection and
+// losing the mutex, at the cost of a small amount of memory and a somewhat
+// significant increase in code complexity.
+var globalLocationCache = &locationCache{cache: make(map[int]*time.Location)}
+
+func Reset() {
+ globalLocationCache = &locationCache{cache: make(map[int]*time.Location)}
+}
+
+// Returns the cached timezone for the specified offset, creating and caching
+// it if necessary.
+func (c *locationCache) getLocation(offset int) *time.Location {
+ c.lock.Lock()
+ defer c.lock.Unlock()
+ l, ok := c.cache[offset]
+ if !ok {
+ // TODO(v2): for offset=0 it should use some descriptive text like
+ // "without time zone".
+ l = time.FixedZone("", offset)
+ c.cache[offset] = l
+ }
+ return l
+}
diff --git a/vendor/github.com/lib/pq/internal/pqtime/pqtime.go b/vendor/github.com/lib/pq/internal/pqtime/pqtime.go
@@ -0,0 +1,190 @@
+package pqtime
+
+import (
+ "errors"
+ "fmt"
+ "math"
+ "strconv"
+ "strings"
+ "time"
+)
+
+var errInvalidTimestamp = errors.New("invalid timestamp")
+
+type timestampParser struct {
+ err error
+}
+
+func (p *timestampParser) expect(str string, char byte, pos int) {
+ if p.err != nil {
+ return
+ }
+ if pos+1 > len(str) {
+ p.err = errInvalidTimestamp
+ return
+ }
+ if c := str[pos]; c != char && p.err == nil {
+ p.err = fmt.Errorf("expected '%v' at position %v; got '%v'", char, pos, c)
+ }
+}
+
+func (p *timestampParser) mustAtoi(str string, begin int, end int) int {
+ if p.err != nil {
+ return 0
+ }
+ if begin < 0 || end < 0 || begin > end || end > len(str) {
+ p.err = errInvalidTimestamp
+ return 0
+ }
+ result, err := strconv.Atoi(str[begin:end])
+ if err != nil {
+ if p.err == nil {
+ p.err = fmt.Errorf("expected number; got '%v'", str)
+ }
+ return 0
+ }
+ return result
+}
+
+func Parse(currentLocation *time.Location, str string) (time.Time, error) {
+ p := timestampParser{}
+
+ monSep := strings.IndexRune(str, '-')
+ // this is Gregorian year, not ISO Year
+ // In Gregorian system, the year 1 BC is followed by AD 1
+ year := p.mustAtoi(str, 0, monSep)
+ daySep := monSep + 3
+ month := p.mustAtoi(str, monSep+1, daySep)
+ p.expect(str, '-', daySep)
+ timeSep := daySep + 3
+ day := p.mustAtoi(str, daySep+1, timeSep)
+
+ minLen := monSep + len("01-01") + 1
+
+ isBC := strings.HasSuffix(str, " BC")
+ if isBC {
+ minLen += 3
+ }
+
+ var hour, minute, second int
+ if len(str) > minLen {
+ p.expect(str, ' ', timeSep)
+ minSep := timeSep + 3
+ p.expect(str, ':', minSep)
+ hour = p.mustAtoi(str, timeSep+1, minSep)
+ secSep := minSep + 3
+ p.expect(str, ':', secSep)
+ minute = p.mustAtoi(str, minSep+1, secSep)
+ secEnd := secSep + 3
+ second = p.mustAtoi(str, secSep+1, secEnd)
+ }
+ remainderIdx := monSep + len("01-01 00:00:00") + 1
+ // Three optional (but ordered) sections follow: the
+ // fractional seconds, the time zone offset, and the BC
+ // designation. We set them up here and adjust the other
+ // offsets if the preceding sections exist.
+
+ nanoSec := 0
+ tzOff := 0
+
+ if remainderIdx < len(str) && str[remainderIdx] == '.' {
+ fracStart := remainderIdx + 1
+ fracOff := strings.IndexAny(str[fracStart:], "-+Z ")
+ if fracOff < 0 {
+ fracOff = len(str) - fracStart
+ }
+ fracSec := p.mustAtoi(str, fracStart, fracStart+fracOff)
+ nanoSec = fracSec * (1000000000 / int(math.Pow(10, float64(fracOff))))
+
+ remainderIdx += fracOff + 1
+ }
+ if tzStart := remainderIdx; tzStart < len(str) && (str[tzStart] == '-' || str[tzStart] == '+') {
+ // time zone separator is always '-' or '+' or 'Z' (UTC is +00)
+ var tzSign int
+ switch c := str[tzStart]; c {
+ case '-':
+ tzSign = -1
+ case '+':
+ tzSign = +1
+ default:
+ return time.Time{}, fmt.Errorf("expected '-' or '+' at position %v; got %v", tzStart, c)
+ }
+ tzHours := p.mustAtoi(str, tzStart+1, tzStart+3)
+ remainderIdx += 3
+ var tzMin, tzSec int
+ if remainderIdx < len(str) && str[remainderIdx] == ':' {
+ tzMin = p.mustAtoi(str, remainderIdx+1, remainderIdx+3)
+ remainderIdx += 3
+ }
+ if remainderIdx < len(str) && str[remainderIdx] == ':' {
+ tzSec = p.mustAtoi(str, remainderIdx+1, remainderIdx+3)
+ remainderIdx += 3
+ }
+ tzOff = tzSign * ((tzHours * 60 * 60) + (tzMin * 60) + tzSec)
+ } else if tzStart < len(str) && str[tzStart] == 'Z' {
+ // time zone Z separator indicates UTC is +00
+ remainderIdx += 1
+ }
+
+ var isoYear int
+
+ if isBC {
+ isoYear = 1 - year
+ remainderIdx += 3
+ } else {
+ isoYear = year
+ }
+ if remainderIdx < len(str) {
+ return time.Time{}, fmt.Errorf("expected end of input, got %v", str[remainderIdx:])
+ }
+ t := time.Date(isoYear, time.Month(month), day,
+ hour, minute, second, nanoSec,
+ globalLocationCache.getLocation(tzOff))
+
+ if currentLocation != nil {
+ // Set the location of the returned Time based on the session's
+ // TimeZone value, but only if the local time zone database agrees with
+ // the remote database on the offset.
+ lt := t.In(currentLocation)
+ _, newOff := lt.Zone()
+ if newOff == tzOff {
+ t = lt
+ }
+ }
+
+ return t, p.err
+}
+
+// Format into Postgres' text format for timestamps.
+func Format(t time.Time) []byte {
+ // Need to send dates before 0001 A.D. with " BC" suffix, instead of the
+ // minus sign preferred by Go.
+ // Beware, "0000" in ISO is "1 BC", "-0001" is "2 BC" and so on
+ bc := false
+ if t.Year() <= 0 {
+ // flip year sign, and add 1, e.g: "0" will be "1", and "-10" will be "11"
+ t = t.AddDate((-t.Year())*2+1, 0, 0)
+ bc = true
+ }
+ b := []byte(t.Format("2006-01-02 15:04:05.999999999Z07:00"))
+
+ _, offset := t.Zone()
+ offset %= 60
+ if offset != 0 {
+ // RFC3339Nano already printed the minus sign
+ if offset < 0 {
+ offset = -offset
+ }
+
+ b = append(b, ':')
+ if offset < 10 {
+ b = append(b, '0')
+ }
+ b = strconv.AppendInt(b, int64(offset), 10)
+ }
+
+ if bc {
+ b = append(b, " BC"...)
+ }
+ return b
+}
diff --git a/vendor/github.com/lib/pq/internal/pqutil/path.go b/vendor/github.com/lib/pq/internal/pqutil/path.go
@@ -0,0 +1,91 @@
+package pqutil
+
+import (
+ "errors"
+ "fmt"
+ "io"
+ "os"
+ "os/user"
+ "path/filepath"
+ "runtime"
+ "syscall"
+)
+
+// Home gets the PostgreSQL configuration dir in the user's home directory:
+// %APPDATA%/postgresql on Windows, and $HOME/.postgresql/postgresql.crt
+// everywhere else.
+//
+// Returns an empy string if no home directory was found.
+//
+// Matches pqGetHomeDirectory() from PostgreSQL.
+// https://github.com/postgres/postgres/blob/2b117bb/src/interfaces/libpq/fe-connect.c#L8214
+func Home(subdir bool) string {
+ if runtime.GOOS == "windows" {
+ // pq uses SHGetFolderPath(), which is deprecated but x/sys/windows has
+ // KnownFolderPath(). We don't really want to pull that in though, so
+ // use APPDATA env. This is also what PostgreSQL uses in some other
+ // codepaths (get_home_path() for example).
+ ad := os.Getenv("APPDATA")
+ if ad == "" {
+ return ""
+ }
+ return filepath.Join(ad, "postgresql")
+ }
+
+ home, _ := os.UserHomeDir()
+ if home == "" {
+ u, err := user.Current()
+ if err != nil {
+ return ""
+ }
+ home = u.HomeDir
+ }
+ // libpq reads some files from ~/ and some from ~/.postgresql – on Windows
+ // it always uses %APPDATA%/postgresql.
+ if subdir {
+ home = filepath.Join(home, ".postgresql")
+ }
+ return home
+}
+
+// ErrNotExists reports if err is a "path doesn't exist" type error.
+//
+// fs.ErrNotExist is not enough, as "/dev/null/somefile" will return ENOTDIR
+// instead of ENOENT.
+func ErrNotExists(err error) bool {
+ perr := new(os.PathError)
+ if errors.As(err, &perr) && (perr.Err == syscall.ENOENT || perr.Err == syscall.ENOTDIR) {
+ return true
+ }
+ return false
+}
+
+var WarnFD io.Writer = os.Stderr
+
+// Pgpass gets the filepath to the pgpass file to use, returning "" if a pgpass
+// file shouldn't be used.
+func Pgpass(passfile string) string {
+ // Get passfile from the options.
+ if passfile == "" {
+ home := Home(false)
+ if home == "" {
+ return ""
+ }
+ passfile = filepath.Join(home, ".pgpass")
+ }
+
+ // On Win32, the directory is protected, so we don't have to check the file.
+ if runtime.GOOS != "windows" {
+ fi, err := os.Stat(passfile)
+ if err != nil {
+ return ""
+ }
+ if fi.Mode().Perm()&(0x77) != 0 {
+ fmt.Fprintf(WarnFD,
+ "WARNING: password file %q has group or world access; permissions should be u=rw (0600) or less\n",
+ passfile)
+ return ""
+ }
+ }
+ return passfile
+}
diff --git a/vendor/github.com/lib/pq/internal/pqutil/perm.go b/vendor/github.com/lib/pq/internal/pqutil/perm.go
@@ -0,0 +1,64 @@
+//go:build !windows && !plan9
+
+package pqutil
+
+import (
+ "errors"
+ "os"
+ "syscall"
+)
+
+var (
+ ErrSSLKeyUnknownOwnership = errors.New("pq: could not get owner information for private key, may not be properly protected")
+ ErrSSLKeyHasWorldPermissions = errors.New("pq: private key has world access; permissions should be u=rw,g=r (0640) if owned by root, or u=rw (0600), or less")
+)
+
+// SSLKeyPermissions checks the permissions on user-supplied SSL key files,
+// which should have very little access. libpq does not check key file
+// permissions on Windows.
+//
+// If the file is owned by the same user the process is running as, the file
+// should only have 0600. If the file is owned by root, and the group matches
+// the group that the process is running in, the permissions cannot be more than
+// 0640. The file should never have world permissions.
+//
+// Returns an error when the permission check fails.
+func SSLKeyPermissions(sslkey string) error {
+ fi, err := os.Stat(sslkey)
+ if err != nil {
+ return err
+ }
+
+ return CheckPermissions(fi)
+}
+
+func CheckPermissions(fi os.FileInfo) error {
+ // The maximum permissions that a private key file owned by a regular user
+ // is allowed to have. This translates to u=rw. Regardless of if we're
+ // running as root or not, 0600 is acceptable, so we return if no bits
+ // beyond the regular user permission mask are set.
+ if fi.Mode().Perm()&^os.FileMode(0o600) == 0 {
+ return nil
+ }
+
+ // We need to pull the Unix file information to get the file's owner.
+ // If we can't access it, there's some sort of operating system level error
+ // and we should fail rather than attempting to use faulty information.
+ sys, ok := fi.Sys().(*syscall.Stat_t)
+ if !ok {
+ return ErrSSLKeyUnknownOwnership
+ }
+
+ // if the file is owned by root, we allow 0640 (u=rw,g=r) to match what
+ // Postgres does.
+ if sys.Uid == 0 {
+ // The maximum permissions that a private key file owned by root is
+ // allowed to have. This translates to u=rw,g=r.
+ if fi.Mode().Perm()&^os.FileMode(0o640) != 0 {
+ return ErrSSLKeyHasWorldPermissions
+ }
+ return nil
+ }
+
+ return ErrSSLKeyHasWorldPermissions
+}
diff --git a/vendor/github.com/lib/pq/internal/pqutil/perm_unsupported.go b/vendor/github.com/lib/pq/internal/pqutil/perm_unsupported.go
@@ -0,0 +1,12 @@
+//go:build windows || plan9
+
+package pqutil
+
+import "errors"
+
+var (
+ ErrSSLKeyUnknownOwnership = errors.New("unused")
+ ErrSSLKeyHasWorldPermissions = errors.New("unused")
+)
+
+func SSLKeyPermissions(sslkey string) error { return nil }
diff --git a/vendor/github.com/lib/pq/internal/pqutil/pqutil.go b/vendor/github.com/lib/pq/internal/pqutil/pqutil.go
@@ -0,0 +1,32 @@
+package pqutil
+
+import (
+ "strconv"
+ "strings"
+)
+
+// ParseBool is like strconv.ParseBool, but also accepts "yes"/"no" and
+// "on"/"off".
+func ParseBool(str string) (bool, error) {
+ switch str {
+ case "1", "t", "T", "true", "TRUE", "True", "yes", "on":
+ return true, nil
+ case "0", "f", "F", "false", "FALSE", "False", "no", "off":
+ return false, nil
+ }
+ return false, &strconv.NumError{Func: "ParseBool", Num: str, Err: strconv.ErrSyntax}
+}
+
+func Join[S ~[]E, E ~string](s S) string {
+ var b strings.Builder
+ for i := range s {
+ if i > 0 {
+ b.WriteString(", ")
+ }
+ if i == len(s)-1 {
+ b.WriteString("or ")
+ }
+ b.WriteString(string(s[i]))
+ }
+ return b.String()
+}
diff --git a/vendor/github.com/lib/pq/internal/pqutil/user_other.go b/vendor/github.com/lib/pq/internal/pqutil/user_other.go
@@ -0,0 +1,9 @@
+//go:build js || android || hurd || zos || wasip1 || appengine
+
+package pqutil
+
+import "errors"
+
+func User() (string, error) {
+ return "", errors.New("pqutil.User: not supported on current platform")
+}
diff --git a/vendor/github.com/lib/pq/internal/pqutil/user_posix.go b/vendor/github.com/lib/pq/internal/pqutil/user_posix.go
@@ -0,0 +1,25 @@
+//go:build !windows && !js && !android && !hurd && !zos && !wasip1 && !appengine
+
+package pqutil
+
+import (
+ "os"
+ "os/user"
+ "runtime"
+)
+
+func User() (string, error) {
+ env := "USER"
+ if runtime.GOOS == "plan9" {
+ env = "user"
+ }
+ if n := os.Getenv(env); n != "" {
+ return n, nil
+ }
+
+ u, err := user.Current()
+ if err != nil {
+ return "", err
+ }
+ return u.Username, nil
+}
diff --git a/vendor/github.com/lib/pq/internal/pqutil/user_windows.go b/vendor/github.com/lib/pq/internal/pqutil/user_windows.go
@@ -0,0 +1,28 @@
+//go:build windows && !appengine
+
+package pqutil
+
+import (
+ "path/filepath"
+ "syscall"
+)
+
+func User() (string, error) {
+ // Perform Windows user name lookup identically to libpq.
+ //
+ // The PostgreSQL code makes use of the legacy Win32 function GetUserName,
+ // and that function has not been imported into stock Go. GetUserNameEx is
+ // available though, the difference being that a wider range of names are
+ // available. To get the output to be the same as GetUserName, only the
+ // base (or last) component of the result is returned.
+ var (
+ name = make([]uint16, 128)
+ pwnameSz = uint32(len(name)) - 1
+ )
+ err := syscall.GetUserNameEx(syscall.NameSamCompatible, &name[0], &pwnameSz)
+ if err != nil {
+ return "", err
+ }
+ s := syscall.UTF16ToString(name)
+ return filepath.Base(s), nil
+}
diff --git a/vendor/github.com/lib/pq/internal/proto/proto.go b/vendor/github.com/lib/pq/internal/proto/proto.go
@@ -0,0 +1,186 @@
+// From src/include/libpq/protocol.h and src/include/libpq/pqcomm.h – PostgreSQL 18.1
+
+package proto
+
+import (
+ "fmt"
+ "strconv"
+)
+
+// Constants from pqcomm.h
+const (
+ ProtocolVersion30 = (3 << 16) | 0 //lint:ignore SA4016 x
+ ProtocolVersion32 = (3 << 16) | 2 // PostgreSQL ≥18.
+ CancelRequestCode = (1234 << 16) | 5678
+ NegotiateSSLCode = (1234 << 16) | 5679
+ NegotiateGSSCode = (1234 << 16) | 5680
+)
+
+// Constants from fe-connect.c
+const (
+ MaxErrlen = 30_000 // https://github.com/postgres/postgres/blob/c6a10a89f/src/interfaces/libpq/fe-connect.c#L4067
+)
+
+// RequestCode is a request codes sent by the frontend.
+type RequestCode byte
+
+// These are the request codes sent by the frontend.
+const (
+ Bind = RequestCode('B')
+ Close = RequestCode('C')
+ Describe = RequestCode('D')
+ Execute = RequestCode('E')
+ FunctionCall = RequestCode('F')
+ Flush = RequestCode('H')
+ Parse = RequestCode('P')
+ Query = RequestCode('Q')
+ Sync = RequestCode('S')
+ Terminate = RequestCode('X')
+ CopyFail = RequestCode('f')
+ GSSResponse = RequestCode('p')
+ PasswordMessage = RequestCode('p')
+ SASLInitialResponse = RequestCode('p')
+ SASLResponse = RequestCode('p')
+ CopyDoneRequest = RequestCode('c')
+ CopyDataRequest = RequestCode('d')
+)
+
+func (r RequestCode) String() string {
+ s, ok := map[RequestCode]string{
+ Bind: "Bind",
+ Close: "Close",
+ Describe: "Describe",
+ Execute: "Execute",
+ FunctionCall: "FunctionCall",
+ Flush: "Flush",
+ Parse: "Parse",
+ Query: "Query",
+ Sync: "Sync",
+ Terminate: "Terminate",
+ CopyFail: "CopyFail",
+ // These are all the same :-/
+ //GSSResponse: "GSSResponse",
+ PasswordMessage: "PasswordMessage",
+ //SASLInitialResponse: "SASLInitialResponse",
+ //SASLResponse: "SASLResponse",
+ CopyDoneRequest: "CopyDone",
+ CopyDataRequest: "CopyData",
+ }[r]
+ if !ok {
+ s = "<unknown>"
+ }
+ c := string(r)
+ if r <= 0x1f || r == 0x7f {
+ c = fmt.Sprintf("0x%x", string(r))
+ }
+ return "(" + c + ") " + s
+}
+
+// ResponseCode is a response codes sent by the backend.
+type ResponseCode byte
+
+// These are the response codes sent by the backend.
+const (
+ ParseComplete = ResponseCode('1')
+ BindComplete = ResponseCode('2')
+ CloseComplete = ResponseCode('3')
+ NotificationResponse = ResponseCode('A')
+ CommandComplete = ResponseCode('C')
+ DataRow = ResponseCode('D')
+ ErrorResponse = ResponseCode('E')
+ CopyInResponse = ResponseCode('G')
+ CopyOutResponse = ResponseCode('H')
+ EmptyQueryResponse = ResponseCode('I')
+ BackendKeyData = ResponseCode('K')
+ NoticeResponse = ResponseCode('N')
+ AuthenticationRequest = ResponseCode('R')
+ ParameterStatus = ResponseCode('S')
+ RowDescription = ResponseCode('T')
+ FunctionCallResponse = ResponseCode('V')
+ CopyBothResponse = ResponseCode('W')
+ ReadyForQuery = ResponseCode('Z')
+ NoData = ResponseCode('n')
+ PortalSuspended = ResponseCode('s')
+ ParameterDescription = ResponseCode('t')
+ NegotiateProtocolVersion = ResponseCode('v')
+ CopyDoneResponse = ResponseCode('c')
+ CopyDataResponse = ResponseCode('d')
+)
+
+func (r ResponseCode) String() string {
+ s, ok := map[ResponseCode]string{
+ ParseComplete: "ParseComplete",
+ BindComplete: "BindComplete",
+ CloseComplete: "CloseComplete",
+ NotificationResponse: "NotificationResponse",
+ CommandComplete: "CommandComplete",
+ DataRow: "DataRow",
+ ErrorResponse: "ErrorResponse",
+ CopyInResponse: "CopyInResponse",
+ CopyOutResponse: "CopyOutResponse",
+ EmptyQueryResponse: "EmptyQueryResponse",
+ BackendKeyData: "BackendKeyData",
+ NoticeResponse: "NoticeResponse",
+ AuthenticationRequest: "AuthRequest",
+ ParameterStatus: "ParamStatus",
+ RowDescription: "RowDescription",
+ FunctionCallResponse: "FunctionCallResponse",
+ CopyBothResponse: "CopyBothResponse",
+ ReadyForQuery: "ReadyForQuery",
+ NoData: "NoData",
+ PortalSuspended: "PortalSuspended",
+ ParameterDescription: "ParamDescription",
+ NegotiateProtocolVersion: "NegotiateProtocolVersion",
+ CopyDoneResponse: "CopyDone",
+ CopyDataResponse: "CopyData",
+ }[r]
+ if !ok {
+ s = "<unknown>"
+ }
+ c := string(r)
+ if r <= 0x1f || r == 0x7f {
+ c = fmt.Sprintf("0x%x", string(r))
+ }
+ return "(" + c + ") " + s
+}
+
+// AuthCode are authentication request codes sent by the backend.
+type AuthCode int32
+
+// These are the authentication request codes sent by the backend.
+const (
+ AuthReqOk = AuthCode(0) // User is authenticated
+ AuthReqKrb4 = AuthCode(1) // Kerberos V4. Not supported any more.
+ AuthReqKrb5 = AuthCode(2) // Kerberos V5. Not supported any more.
+ AuthReqPassword = AuthCode(3) // Password
+ AuthReqCrypt = AuthCode(4) // crypt password. Not supported any more.
+ AuthReqMD5 = AuthCode(5) // md5 password
+ _ = AuthCode(6) // 6 is available. It was used for SCM creds, not supported any more.
+ AuthReqGSS = AuthCode(7) // GSSAPI without wrap()
+ AuthReqGSSCont = AuthCode(8) // Continue GSS exchanges
+ AuthReqSSPI = AuthCode(9) // SSPI negotiate without wrap()
+ AuthReqSASL = AuthCode(10) // Begin SASL authentication
+ AuthReqSASLCont = AuthCode(11) // Continue SASL authentication
+ AuthReqSASLFin = AuthCode(12) // Final SASL message
+)
+
+func (a AuthCode) String() string {
+ s, ok := map[AuthCode]string{
+ AuthReqOk: "ok",
+ AuthReqKrb4: "krb4",
+ AuthReqKrb5: "krb5",
+ AuthReqPassword: "password",
+ AuthReqCrypt: "crypt",
+ AuthReqMD5: "md5",
+ AuthReqGSS: "GDD",
+ AuthReqGSSCont: "GSSCont",
+ AuthReqSSPI: "SSPI",
+ AuthReqSASL: "SASL",
+ AuthReqSASLCont: "SASLCont",
+ AuthReqSASLFin: "SASLFin",
+ }[a]
+ if !ok {
+ s = "<unknown>"
+ }
+ return s + " (" + strconv.Itoa(int(a)) + ")"
+}
diff --git a/vendor/github.com/lib/pq/internal/proto/sz_32.go b/vendor/github.com/lib/pq/internal/proto/sz_32.go
@@ -0,0 +1,7 @@
+//go:build 386 || arm || mips || mipsle
+
+package proto
+
+import "math"
+
+const MaxUint32 = math.MaxInt
diff --git a/vendor/github.com/lib/pq/internal/proto/sz_64.go b/vendor/github.com/lib/pq/internal/proto/sz_64.go
@@ -0,0 +1,7 @@
+//go:build !386 && !arm && !mips && !mipsle
+
+package proto
+
+import "math"
+
+const MaxUint32 = math.MaxUint32
diff --git a/vendor/github.com/lib/pq/krb.go b/vendor/github.com/lib/pq/krb.go
@@ -0,0 +1,27 @@
+package pq
+
+// NewGSSFunc creates a GSS authentication provider, for use with
+// RegisterGSSProvider.
+type NewGSSFunc func() (GSS, error)
+
+var newGss NewGSSFunc
+
+// RegisterGSSProvider registers a GSS authentication provider. For example, if
+// you need to use Kerberos to authenticate with your server, add this to your
+// main package:
+//
+// import "github.com/lib/pq/auth/kerberos"
+//
+// func init() {
+// pq.RegisterGSSProvider(func() (pq.GSS, error) { return kerberos.NewGSS() })
+// }
+func RegisterGSSProvider(newGssArg NewGSSFunc) {
+ newGss = newGssArg
+}
+
+// GSS provides GSSAPI authentication (e.g., Kerberos).
+type GSS interface {
+ GetInitToken(host string, service string) ([]byte, error)
+ GetInitTokenFromSpn(spn string) ([]byte, error)
+ Continue(inToken []byte) (done bool, outToken []byte, err error)
+}
diff --git a/vendor/github.com/lib/pq/notice.go b/vendor/github.com/lib/pq/notice.go
@@ -0,0 +1,69 @@
+package pq
+
+import (
+ "context"
+ "database/sql/driver"
+)
+
+// NoticeHandler returns the notice handler on the given connection, if any. A
+// runtime panic occurs if c is not a pq connection. This is rarely used
+// directly, use [ConnectorNoticeHandler] and [ConnectorWithNoticeHandler] instead.
+func NoticeHandler(c driver.Conn) func(*Error) {
+ return c.(*conn).noticeHandler
+}
+
+// SetNoticeHandler sets the given notice handler on the given connection. A
+// runtime panic occurs if c is not a pq connection. A nil handler may be used
+// to unset it. This is rarely used directly, use ConnectorNoticeHandler and
+// [ConnectorWithNoticeHandler] instead.
+//
+// Note: Notice handlers are executed synchronously by pq meaning commands
+// won't continue to be processed until the handler returns.
+func SetNoticeHandler(c driver.Conn, handler func(*Error)) {
+ c.(*conn).noticeHandler = handler
+}
+
+// NoticeHandlerConnector wraps a regular connector and sets a notice handler
+// on it.
+type NoticeHandlerConnector struct {
+ driver.Connector
+ noticeHandler func(*Error)
+}
+
+// Connect calls the underlying connector's connect method and then sets the
+// notice handler.
+func (n *NoticeHandlerConnector) Connect(ctx context.Context) (driver.Conn, error) {
+ c, err := n.Connector.Connect(ctx)
+ if err == nil {
+ SetNoticeHandler(c, n.noticeHandler)
+ }
+ return c, err
+}
+
+// ConnectorNoticeHandler returns the currently set notice handler, if any. If
+// the given connector is not a result of [ConnectorWithNoticeHandler], nil is
+// returned.
+func ConnectorNoticeHandler(c driver.Connector) func(*Error) {
+ if c, ok := c.(*NoticeHandlerConnector); ok {
+ return c.noticeHandler
+ }
+ return nil
+}
+
+// ConnectorWithNoticeHandler creates or sets the given handler for the given
+// connector. If the given connector is a result of calling this function
+// previously, it is simply set on the given connector and returned. Otherwise,
+// this returns a new connector wrapping the given one and setting the notice
+// handler. A nil notice handler may be used to unset it.
+//
+// The returned connector is intended to be used with database/sql.OpenDB.
+//
+// Note: Notice handlers are executed synchronously by pq meaning commands
+// won't continue to be processed until the handler returns.
+func ConnectorWithNoticeHandler(c driver.Connector, handler func(*Error)) *NoticeHandlerConnector {
+ if c, ok := c.(*NoticeHandlerConnector); ok {
+ c.noticeHandler = handler
+ return c
+ }
+ return &NoticeHandlerConnector{Connector: c, noticeHandler: handler}
+}
diff --git a/vendor/github.com/lib/pq/notify.go b/vendor/github.com/lib/pq/notify.go
@@ -0,0 +1,834 @@
+package pq
+
+import (
+ "context"
+ "database/sql/driver"
+ "errors"
+ "fmt"
+ "net"
+ "sync"
+ "sync/atomic"
+ "time"
+
+ "github.com/lib/pq/internal/proto"
+)
+
+// Notification represents a single notification from the database.
+type Notification struct {
+ BePid int // Process ID (PID) of the notifying postgres backend.
+ Channel string // Name of the channel the notification was sent on.
+ Extra string // Payload, or the empty string if unspecified.
+}
+
+func recvNotification(r *readBuf) *Notification {
+ bePid := r.int32()
+ channel := r.string()
+ extra := r.string()
+ return &Notification{bePid, channel, extra}
+}
+
+// SetNotificationHandler sets the given notification handler on the given
+// connection. A runtime panic occurs if c is not a pq connection. A nil handler
+// may be used to unset it.
+//
+// Note: Notification handlers are executed synchronously by pq meaning commands
+// won't continue to be processed until the handler returns.
+func SetNotificationHandler(c driver.Conn, handler func(*Notification)) {
+ c.(*conn).notificationHandler = handler
+}
+
+// NotificationHandlerConnector wraps a regular connector and sets a
+// notification handler on it.
+type NotificationHandlerConnector struct {
+ driver.Connector
+ notificationHandler func(*Notification)
+}
+
+// Connect calls the underlying connector's connect method and then sets the
+// notification handler.
+func (n *NotificationHandlerConnector) Connect(ctx context.Context) (driver.Conn, error) {
+ c, err := n.Connector.Connect(ctx)
+ if err == nil {
+ SetNotificationHandler(c, n.notificationHandler)
+ }
+ return c, err
+}
+
+// ConnectorNotificationHandler returns the currently set notification handler,
+// if any. If the given connector is not a result of
+// [ConnectorWithNotificationHandler], nil is returned.
+func ConnectorNotificationHandler(c driver.Connector) func(*Notification) {
+ if c, ok := c.(*NotificationHandlerConnector); ok {
+ return c.notificationHandler
+ }
+ return nil
+}
+
+// ConnectorWithNotificationHandler creates or sets the given handler for the
+// given connector. If the given connector is a result of calling this function
+// previously, it is simply set on the given connector and returned. Otherwise,
+// this returns a new connector wrapping the given one and setting the
+// notification handler. A nil notification handler may be used to unset it.
+//
+// The returned connector is intended to be used with database/sql.OpenDB.
+//
+// Note: Notification handlers are executed synchronously by pq meaning commands
+// won't continue to be processed until the handler returns.
+func ConnectorWithNotificationHandler(c driver.Connector, handler func(*Notification)) *NotificationHandlerConnector {
+ if c, ok := c.(*NotificationHandlerConnector); ok {
+ c.notificationHandler = handler
+ return c
+ }
+ return &NotificationHandlerConnector{Connector: c, notificationHandler: handler}
+}
+
+const (
+ connStateIdle int32 = iota
+ connStateExpectResponse
+ connStateExpectReadyForQuery
+)
+
+type message struct {
+ typ proto.ResponseCode
+ err error
+}
+
+var errListenerConnClosed = errors.New("pq: ListenerConn has been closed")
+
+// ListenerConn is a low-level interface for waiting for notifications. You
+// should use [Listener] instead.
+type ListenerConn struct {
+ connectionLock sync.Mutex // guards cn and err
+ senderLock sync.Mutex // the sending goroutine will be holding this lock
+ cn *conn
+ err error
+ connState int32
+ notificationChan chan<- *Notification
+ replyChan chan message
+}
+
+// NewListenerConn creates a new ListenerConn. Use NewListener instead.
+func NewListenerConn(name string, notificationChan chan<- *Notification) (*ListenerConn, error) {
+ return newDialListenerConn(defaultDialer{}, name, notificationChan)
+}
+
+func newDialListenerConn(d Dialer, name string, c chan<- *Notification) (*ListenerConn, error) {
+ cn, err := DialOpen(d, name)
+ if err != nil {
+ return nil, err
+ }
+
+ l := &ListenerConn{
+ cn: cn.(*conn),
+ notificationChan: c,
+ connState: connStateIdle,
+ replyChan: make(chan message, 2),
+ }
+
+ go l.listenerConnMain()
+ return l, nil
+}
+
+// We can only allow one goroutine at a time to be running a query on the
+// connection for various reasons, so the goroutine sending on the connection
+// must be holding senderLock.
+//
+// Returns an error if an unrecoverable error has occurred and the ListenerConn
+// should be abandoned.
+func (l *ListenerConn) acquireSenderLock() error {
+ // we must acquire senderLock first to avoid deadlocks; see ExecSimpleQuery
+ l.senderLock.Lock()
+
+ l.connectionLock.Lock()
+ err := l.err
+ l.connectionLock.Unlock()
+ if err != nil {
+ l.senderLock.Unlock()
+ return err
+ }
+ return nil
+}
+
+func (l *ListenerConn) releaseSenderLock() {
+ l.senderLock.Unlock()
+}
+
+// setState advances the protocol state to newState. Returns false if moving
+// to that state from the current state is not allowed.
+func (l *ListenerConn) setState(newState int32) bool {
+ var expectedState int32
+
+ switch newState {
+ case connStateIdle:
+ expectedState = connStateExpectReadyForQuery
+ case connStateExpectResponse:
+ expectedState = connStateIdle
+ case connStateExpectReadyForQuery:
+ expectedState = connStateExpectResponse
+ default:
+ panic(fmt.Sprintf("unexpected listenerConnState %d", newState))
+ }
+
+ return atomic.CompareAndSwapInt32(&l.connState, expectedState, newState)
+}
+
+// Main logic is here: receive messages from the postgres backend, forward
+// notifications and query replies and keep the internal state in sync with the
+// protocol state. Returns when the connection has been lost, is about to go
+// away or should be discarded because we couldn't agree on the state with the
+// server backend.
+func (l *ListenerConn) listenerConnLoop() (err error) {
+ r := &readBuf{}
+ for {
+ t, err := l.cn.recvMessage(r)
+ if err != nil {
+ return err
+ }
+
+ switch t {
+ case proto.NotificationResponse:
+ // recvNotification copies all the data so we don't need to worry
+ // about the scratch buffer being overwritten.
+ l.notificationChan <- recvNotification(r)
+
+ case proto.RowDescription, proto.DataRow:
+ // only used by tests; ignore
+
+ case proto.ErrorResponse:
+ // We might receive an ErrorResponse even when not in a query; it
+ // is expected that the server will close the connection after
+ // that, but we should make sure that the error we display is the
+ // one from the stray ErrorResponse, not io.ErrUnexpectedEOF.
+ if !l.setState(connStateExpectReadyForQuery) {
+ return parseError(r, "")
+ }
+ l.replyChan <- message{t, parseError(r, "")}
+
+ case proto.CommandComplete, proto.EmptyQueryResponse:
+ if !l.setState(connStateExpectReadyForQuery) {
+ // protocol out of sync
+ return fmt.Errorf("unexpected CommandComplete")
+ }
+ // ExecSimpleQuery doesn't need to know about this message
+
+ case proto.ReadyForQuery:
+ if !l.setState(connStateIdle) {
+ // protocol out of sync
+ return fmt.Errorf("unexpected ReadyForQuery")
+ }
+ l.replyChan <- message{t, nil}
+
+ case proto.ParameterStatus:
+ // ignore
+ case proto.NoticeResponse:
+ if n := l.cn.noticeHandler; n != nil {
+ n(parseError(r, ""))
+ }
+ default:
+ return fmt.Errorf("unexpected message %q from server in listenerConnLoop", t)
+ }
+ }
+}
+
+// This is the main routine for the goroutine receiving on the database
+// connection. Most of the main logic is in listenerConnLoop.
+func (l *ListenerConn) listenerConnMain() {
+ err := l.listenerConnLoop()
+
+ // listenerConnLoop terminated; we're done, but we still have to clean up.
+ // Make sure nobody tries to start any new queries by making sure the err
+ // pointer is set. It is important that we do not overwrite its value; a
+ // connection could be closed by either this goroutine or one sending on the
+ // connection – whoever closes the connection is assumed to have the more
+ // meaningful error message (as the other one will probably get
+ // net.errClosed), so that goroutine sets the error we expose while the
+ // other error is discarded. If the connection is lost while two goroutines
+ // are operating on the socket, it probably doesn't matter which error we
+ // expose so we don't try to do anything more complex.
+ l.connectionLock.Lock()
+ if l.err == nil {
+ l.err = err
+ }
+ _ = l.cn.Close()
+ l.connectionLock.Unlock()
+
+ // There might be a query in-flight; make sure nobody's waiting for a
+ // response to it, since there's not going to be one.
+ close(l.replyChan)
+
+ // let the listener know we're done
+ close(l.notificationChan)
+
+ // this ListenerConn is done
+}
+
+// Listen sends a LISTEN query to the server. See ExecSimpleQuery.
+func (l *ListenerConn) Listen(channel string) (bool, error) {
+ return l.ExecSimpleQuery("LISTEN " + QuoteIdentifier(channel))
+}
+
+// Unlisten sends an UNLISTEN query to the server. See ExecSimpleQuery.
+func (l *ListenerConn) Unlisten(channel string) (bool, error) {
+ return l.ExecSimpleQuery("UNLISTEN " + QuoteIdentifier(channel))
+}
+
+// UnlistenAll sends an `UNLISTEN *` query to the server. See ExecSimpleQuery.
+func (l *ListenerConn) UnlistenAll() (bool, error) {
+ return l.ExecSimpleQuery("UNLISTEN *")
+}
+
+// Ping the remote server to make sure it's alive. Non-nil error means the
+// connection has failed and should be abandoned.
+func (l *ListenerConn) Ping() error {
+ sent, err := l.ExecSimpleQuery("")
+ if !sent {
+ return err
+ }
+ if err != nil { // shouldn't happen
+ panic(err)
+ }
+ return nil
+}
+
+// Attempt to send a query on the connection. Returns an error if sending the
+// query failed, and the caller should initiate closure of this connection. The
+// caller must be holding senderLock (see acquireSenderLock and
+// releaseSenderLock).
+func (l *ListenerConn) sendSimpleQuery(q string) (err error) {
+ // Must set connection state before sending the query
+ if !l.setState(connStateExpectResponse) {
+ return errors.New("pq: two queries running at the same time")
+ }
+
+ // Can't use l.cn.writeBuf here because it uses the scratch buffer which
+ // might get overwritten by listenerConnLoop.
+ b := &writeBuf{
+ buf: []byte("Q\x00\x00\x00\x00"),
+ pos: 1,
+ }
+ b.string(q)
+ return l.cn.send(b)
+}
+
+// ExecSimpleQuery executes a "simple query" (i.e. one with no bindable
+// parameters) on the connection. The possible return values are:
+// 1. "executed" is true; the query was executed to completion on the database
+// server. If the query failed, err will be set to the error returned by the
+// database, otherwise err will be nil.
+// 2. If "executed" is false, the query could not be executed on the remote
+// server. err will be non-nil.
+//
+// After a call to ExecSimpleQuery has returned an executed=false value, the
+// connection has either been closed or will be closed shortly thereafter, and
+// all subsequently executed queries will return an error.
+func (l *ListenerConn) ExecSimpleQuery(q string) (executed bool, err error) {
+ if err = l.acquireSenderLock(); err != nil {
+ return false, err
+ }
+ defer l.releaseSenderLock()
+
+ err = l.sendSimpleQuery(q)
+ if err != nil {
+ // We can't know what state the protocol is in, so we need to abandon
+ // this connection.
+ l.connectionLock.Lock()
+ // Set the error pointer if it hasn't been set already; see
+ // listenerConnMain.
+ if l.err == nil {
+ l.err = err
+ }
+ l.connectionLock.Unlock()
+ _ = l.cn.c.Close()
+ return false, err
+ }
+
+ // now we just wait for a reply..
+ for {
+ m, ok := <-l.replyChan
+ if !ok {
+ // We lost the connection to server, don't bother waiting for a
+ // a response. err should have been set already.
+ l.connectionLock.Lock()
+ err := l.err
+ l.connectionLock.Unlock()
+ return false, err
+ }
+ switch m.typ {
+ case proto.ReadyForQuery:
+ // sanity check
+ if m.err != nil {
+ panic("m.err != nil")
+ }
+ // done; err might or might not be set
+ return true, err
+
+ case proto.ErrorResponse:
+ // sanity check
+ if m.err == nil {
+ panic("m.err == nil")
+ }
+ // server responded with an error; ReadyForQuery to follow
+ err = m.err
+
+ default:
+ return false, fmt.Errorf("unknown response for simple query: %q", m.typ)
+ }
+ }
+}
+
+// Close closes the connection.
+func (l *ListenerConn) Close() error {
+ l.connectionLock.Lock()
+ if l.err != nil {
+ l.connectionLock.Unlock()
+ return errListenerConnClosed
+ }
+ l.err = errListenerConnClosed
+ l.connectionLock.Unlock()
+ // We can't send anything on the connection without holding senderLock.
+ // Simply close the net.Conn to wake up everyone operating on it.
+ return l.cn.c.Close()
+}
+
+// Err returns the reason the connection was closed. It is not safe to call
+// this function until l.Notify has been closed.
+func (l *ListenerConn) Err() error {
+ return l.err
+}
+
+// ErrChannelAlreadyOpen is returned from Listen when a channel is already
+// open.
+var ErrChannelAlreadyOpen = errors.New("pq: channel is already open")
+
+// ErrChannelNotOpen is returned from Unlisten when a channel is not open.
+var ErrChannelNotOpen = errors.New("pq: channel is not open")
+
+// ListenerEventType is an enumeration of listener event types.
+type ListenerEventType int
+
+const (
+ // ListenerEventConnected is emitted only when the database connection has
+ // been initially initialized. The err argument of the callback will always
+ // be nil.
+ ListenerEventConnected ListenerEventType = iota
+
+ // ListenerEventDisconnected is emitted after a database connection has been
+ // lost, either because of an error or because Close has been called. The
+ // err argument will be set to the reason the database connection was lost.
+ ListenerEventDisconnected
+
+ // ListenerEventReconnected is emitted after a database connection has been
+ // re-established after connection loss. The err argument of the callback
+ // will always be nil. After this event has been emitted, a nil
+ // pq.Notification is sent on the Listener.Notify channel.
+ ListenerEventReconnected
+
+ // ListenerEventConnectionAttemptFailed is emitted after a connection to the
+ // database was attempted, but failed. The err argument will be set to an
+ // error describing why the connection attempt did not succeed.
+ ListenerEventConnectionAttemptFailed
+)
+
+// EventCallbackType is the event callback type. See also ListenerEventType
+// constants' documentation.
+type EventCallbackType func(event ListenerEventType, err error)
+
+func (l ListenerEventType) String() string {
+ return map[ListenerEventType]string{
+ ListenerEventConnected: "connected",
+ ListenerEventDisconnected: "disconnected",
+ ListenerEventReconnected: "reconnected",
+ ListenerEventConnectionAttemptFailed: "connectionAttemptFailed",
+ }[l]
+}
+
+// Listener provides an interface for listening to notifications from a
+// PostgreSQL database. For general usage information, see section
+// "Notifications".
+//
+// Listener can safely be used from concurrently running goroutines.
+type Listener struct {
+ // Channel for receiving notifications from the database. In some cases a
+ // nil value will be sent. See section "Notifications" above.
+ Notify chan *Notification
+
+ dsn string
+ minReconnectInterval time.Duration
+ maxReconnectInterval time.Duration
+ dialer Dialer
+ eventCallback EventCallbackType
+
+ lock sync.Mutex
+ isClosed bool
+ reconnectCond *sync.Cond
+ cn *ListenerConn
+ connNotificationChan <-chan *Notification
+ channels map[string]struct{}
+}
+
+// NewListener creates a new database connection dedicated to LISTEN / NOTIFY.
+//
+// name should be set to a connection string to be used to establish the
+// database connection (see section "Connection String Parameters" above).
+//
+// minReconnect controls the duration to wait before trying to re-establish the
+// database connection after connection loss. After each consecutive failure
+// this interval is doubled, until maxReconnect is reached. Successfully
+// completing the connection establishment procedure resets the interval back to
+// minReconnect.
+//
+// The last parameter cb can be set to a function which will be called by the
+// Listener when the state of the underlying database connection changes. This
+// callback will be called by the goroutine which dispatches the notifications
+// over the Notify channel, so you should try to avoid doing potentially
+// time-consuming operations from the callback.
+func NewListener(dsn string, minReconnect, maxReconnect time.Duration, cb EventCallbackType) *Listener {
+ return NewDialListener(defaultDialer{}, dsn, minReconnect, maxReconnect, cb)
+}
+
+// NewDialListener is like NewListener but it takes a Dialer.
+func NewDialListener(d Dialer, dsn string, minReconnect, maxReconnect time.Duration, cb EventCallbackType) *Listener {
+ l := &Listener{
+ dsn: dsn,
+ minReconnectInterval: minReconnect,
+ maxReconnectInterval: maxReconnect,
+ dialer: d,
+ eventCallback: cb,
+ channels: make(map[string]struct{}),
+ Notify: make(chan *Notification, 32),
+ }
+ l.reconnectCond = sync.NewCond(&l.lock)
+ go l.listenerMain()
+ return l
+}
+
+// NotificationChannel returns the notification channel for this listener. This
+// is the same channel as Notify, and will not be recreated during the life time
+// of the Listener.
+func (l *Listener) NotificationChannel() <-chan *Notification {
+ return l.Notify
+}
+
+// Listen starts listening for notifications on a channel. Calls to this
+// function will block until an acknowledgement has been received from the
+// server. Note that Listener automatically re-establishes the connection after
+// connection loss, so this function may block indefinitely if the connection
+// can not be re-established.
+//
+// Listen will only fail in three conditions:
+// 1. The channel is already open. The returned error will be
+// [ErrChannelAlreadyOpen].
+// 2. The query was executed on the remote server, but PostgreSQL returned an
+// error message in response to the query. The returned error will be a
+// [pq.Error] containing the information the server supplied.
+// 3. Close is called on the Listener before the request could be completed.
+//
+// The channel name is case-sensitive.
+func (l *Listener) Listen(channel string) error {
+ l.lock.Lock()
+ defer l.lock.Unlock()
+ if l.isClosed {
+ return net.ErrClosed
+ }
+
+ // The server allows you to issue a LISTEN on a channel which is already
+ // open, but it seems useful to be able to detect this case to spot for
+ // mistakes in application logic. If the application genuinely does't care,
+ // it can check the exported error and ignore it.
+ _, exists := l.channels[channel]
+ if exists {
+ return ErrChannelAlreadyOpen
+ }
+
+ if l.cn != nil {
+ // If resp is true but error is set then the query was executed on the
+ // remote server but resulted in an error. This should be relatively
+ // rare, so it's fine if we just pass the error to our caller.
+ // If resp is false then we could not complete the query on the remote
+ // server and our underlying connection is about to go away, so we only
+ // add relname to l.channels, and wait for resync() to take care of the
+ // rest.
+ resp, err := l.cn.Listen(channel)
+ if resp && err != nil {
+ return err
+ }
+ }
+
+ l.channels[channel] = struct{}{}
+ for l.cn == nil {
+ l.reconnectCond.Wait()
+ // we let go of the mutex for a while
+ if l.isClosed {
+ return net.ErrClosed
+ }
+ }
+
+ return nil
+}
+
+// Unlisten removes a channel from the Listener's channel list. Returns
+// ErrChannelNotOpen if the Listener is not listening on the specified channel.
+// Returns immediately with no error if there is no connection. Note that you
+// might still get notifications for this channel even after Unlisten has
+// returned.
+//
+// The channel name is case-sensitive.
+func (l *Listener) Unlisten(channel string) error {
+ l.lock.Lock()
+ defer l.lock.Unlock()
+
+ if l.isClosed {
+ return net.ErrClosed
+ }
+
+ // Similarly to LISTEN, this is not an error in Postgres, but it seems
+ // useful to distinguish from the normal conditions.
+ _, exists := l.channels[channel]
+ if !exists {
+ return ErrChannelNotOpen
+ }
+
+ if l.cn != nil {
+ // Similarly to Listen (see comment there), the caller should only be
+ // bothered with an error if it came from the backend as a response to
+ // our query.
+ resp, err := l.cn.Unlisten(channel)
+ if resp && err != nil {
+ return err
+ }
+ }
+
+ // Don't bother waiting for resync if there's no connection.
+ delete(l.channels, channel)
+ return nil
+}
+
+// UnlistenAll removes all channels from the Listener's channel list. Returns
+// immediately with no error if there is no connection. Note that you might
+// still get notifications for any of the deleted channels even after
+// UnlistenAll has returned.
+func (l *Listener) UnlistenAll() error {
+ l.lock.Lock()
+ defer l.lock.Unlock()
+
+ if l.isClosed {
+ return net.ErrClosed
+ }
+
+ if l.cn != nil {
+ // Similarly to Listen (see comment in that function), the caller
+ // should only be bothered with an error if it came from the backend as
+ // a response to our query.
+ gotResponse, err := l.cn.UnlistenAll()
+ if gotResponse && err != nil {
+ return err
+ }
+ }
+
+ // Don't bother waiting for resync if there's no connection.
+ l.channels = make(map[string]struct{})
+ return nil
+}
+
+// Ping the remote server to make sure it's alive. Non-nil return value means
+// that there is no active connection.
+func (l *Listener) Ping() error {
+ l.lock.Lock()
+ defer l.lock.Unlock()
+
+ if l.isClosed {
+ return net.ErrClosed
+ }
+ if l.cn == nil {
+ return errors.New("no connection")
+ }
+
+ return l.cn.Ping()
+}
+
+// Clean up after losing the server connection. Returns l.cn.Err(), which should
+// have the reason the connection was lost.
+func (l *Listener) disconnectCleanup() error {
+ l.lock.Lock()
+ defer l.lock.Unlock()
+
+ // sanity check; can't look at Err() until the channel has been closed
+ select {
+ case _, ok := <-l.connNotificationChan:
+ if ok {
+ panic("connNotificationChan not closed")
+ }
+ default:
+ panic("connNotificationChan not closed")
+ }
+
+ err := l.cn.Err()
+ _ = l.cn.Close()
+ l.cn = nil
+ return err
+}
+
+// Synchronize the list of channels we want to be listening on with the server
+// after the connection has been established.
+func (l *Listener) resync(cn *ListenerConn, notificationChan <-chan *Notification) error {
+ doneChan := make(chan error)
+ go func(notificationChan <-chan *Notification) {
+ for channel := range l.channels {
+ // If we got a response, return that error to our caller as it's
+ // going to be more descriptive than cn.Err().
+ gotResponse, err := cn.Listen(channel)
+ if gotResponse && err != nil {
+ doneChan <- err
+ return
+ }
+
+ // If we couldn't reach the server, wait for notificationChan to
+ // close and then return the error message from the connection, as
+ // per ListenerConn's interface.
+ if err != nil {
+ for range notificationChan {
+ }
+ doneChan <- cn.Err()
+ return
+ }
+ }
+ doneChan <- nil
+ }(notificationChan)
+
+ // Ignore notifications while synchronization is going on to avoid
+ // deadlocks. We have to send a nil notification over Notify anyway as we
+ // can't possibly know which notifications (if any) were lost while the
+ // connection was down, so there's no reason to try and process these
+ // messages at all.
+ for {
+ select {
+ case _, ok := <-notificationChan:
+ if !ok {
+ notificationChan = nil
+ }
+
+ case err := <-doneChan:
+ return err
+ }
+ }
+}
+
+// caller should NOT be holding l.lock
+func (l *Listener) closed() bool {
+ l.lock.Lock()
+ defer l.lock.Unlock()
+
+ return l.isClosed
+}
+
+func (l *Listener) connect() error {
+ l.lock.Lock()
+ defer l.lock.Unlock()
+ if l.isClosed {
+ return net.ErrClosed
+ }
+
+ notificationChan := make(chan *Notification, 32)
+
+ var err error
+ l.cn, err = newDialListenerConn(l.dialer, l.dsn, notificationChan)
+ if err != nil {
+ return err
+ }
+
+ err = l.resync(l.cn, notificationChan)
+ if err != nil {
+ _ = l.cn.Close()
+ return err
+ }
+
+ l.connNotificationChan = notificationChan
+ l.reconnectCond.Broadcast()
+ return nil
+}
+
+// Close disconnects the Listener from the database and shuts it down.
+// Subsequent calls to its methods will return an error. Close returns an error
+// if the connection has already been closed.
+func (l *Listener) Close() error {
+ l.lock.Lock()
+ defer l.lock.Unlock()
+
+ if l.isClosed {
+ return net.ErrClosed
+ }
+
+ if l.cn != nil {
+ _ = l.cn.Close()
+ }
+ l.isClosed = true
+
+ // Unblock calls to Listen()
+ l.reconnectCond.Broadcast()
+
+ return nil
+}
+
+func (l *Listener) emitEvent(event ListenerEventType, err error) {
+ if l.eventCallback != nil {
+ l.eventCallback(event, err)
+ }
+}
+
+// Main logic here: maintain a connection to the server when possible, wait
+// for notifications and emit events.
+func (l *Listener) listenerConnLoop() {
+ var (
+ nextReconnect time.Time
+ reconnectInterval = l.minReconnectInterval
+ )
+ for {
+ for {
+ err := l.connect()
+ if err == nil {
+ break
+ }
+ if l.closed() {
+ return
+ }
+
+ l.emitEvent(ListenerEventConnectionAttemptFailed, err)
+ time.Sleep(reconnectInterval)
+ reconnectInterval *= 2
+ if reconnectInterval > l.maxReconnectInterval {
+ reconnectInterval = l.maxReconnectInterval
+ }
+ }
+
+ if nextReconnect.IsZero() {
+ l.emitEvent(ListenerEventConnected, nil)
+ } else {
+ l.emitEvent(ListenerEventReconnected, nil)
+ l.Notify <- nil
+ }
+
+ reconnectInterval = l.minReconnectInterval
+ nextReconnect = time.Now().Add(reconnectInterval)
+
+ for {
+ notification, ok := <-l.connNotificationChan
+ if !ok { // lost connection, loop again
+ break
+ }
+ l.Notify <- notification
+ }
+
+ err := l.disconnectCleanup()
+ if l.closed() {
+ return
+ }
+ l.emitEvent(ListenerEventDisconnected, err)
+
+ time.Sleep(time.Until(nextReconnect))
+ }
+}
+
+func (l *Listener) listenerMain() {
+ l.listenerConnLoop()
+ close(l.Notify)
+}
diff --git a/vendor/github.com/lib/pq/oid/doc.go b/vendor/github.com/lib/pq/oid/doc.go
@@ -0,0 +1,7 @@
+//go:generate go run ./gen.go
+
+// Package oid contains OID constants as defined by the Postgres server.
+package oid
+
+// Oid is a Postgres Object ID.
+type Oid uint32
diff --git a/vendor/github.com/lib/pq/oid/types.go b/vendor/github.com/lib/pq/oid/types.go
@@ -0,0 +1,343 @@
+// Code generated by gen.go. DO NOT EDIT.
+
+package oid
+
+const (
+ T_bool Oid = 16
+ T_bytea Oid = 17
+ T_char Oid = 18
+ T_name Oid = 19
+ T_int8 Oid = 20
+ T_int2 Oid = 21
+ T_int2vector Oid = 22
+ T_int4 Oid = 23
+ T_regproc Oid = 24
+ T_text Oid = 25
+ T_oid Oid = 26
+ T_tid Oid = 27
+ T_xid Oid = 28
+ T_cid Oid = 29
+ T_oidvector Oid = 30
+ T_pg_ddl_command Oid = 32
+ T_pg_type Oid = 71
+ T_pg_attribute Oid = 75
+ T_pg_proc Oid = 81
+ T_pg_class Oid = 83
+ T_json Oid = 114
+ T_xml Oid = 142
+ T__xml Oid = 143
+ T_pg_node_tree Oid = 194
+ T__json Oid = 199
+ T_smgr Oid = 210
+ T_index_am_handler Oid = 325
+ T_point Oid = 600
+ T_lseg Oid = 601
+ T_path Oid = 602
+ T_box Oid = 603
+ T_polygon Oid = 604
+ T_line Oid = 628
+ T__line Oid = 629
+ T_cidr Oid = 650
+ T__cidr Oid = 651
+ T_float4 Oid = 700
+ T_float8 Oid = 701
+ T_abstime Oid = 702
+ T_reltime Oid = 703
+ T_tinterval Oid = 704
+ T_unknown Oid = 705
+ T_circle Oid = 718
+ T__circle Oid = 719
+ T_money Oid = 790
+ T__money Oid = 791
+ T_macaddr Oid = 829
+ T_inet Oid = 869
+ T__bool Oid = 1000
+ T__bytea Oid = 1001
+ T__char Oid = 1002
+ T__name Oid = 1003
+ T__int2 Oid = 1005
+ T__int2vector Oid = 1006
+ T__int4 Oid = 1007
+ T__regproc Oid = 1008
+ T__text Oid = 1009
+ T__tid Oid = 1010
+ T__xid Oid = 1011
+ T__cid Oid = 1012
+ T__oidvector Oid = 1013
+ T__bpchar Oid = 1014
+ T__varchar Oid = 1015
+ T__int8 Oid = 1016
+ T__point Oid = 1017
+ T__lseg Oid = 1018
+ T__path Oid = 1019
+ T__box Oid = 1020
+ T__float4 Oid = 1021
+ T__float8 Oid = 1022
+ T__abstime Oid = 1023
+ T__reltime Oid = 1024
+ T__tinterval Oid = 1025
+ T__polygon Oid = 1027
+ T__oid Oid = 1028
+ T_aclitem Oid = 1033
+ T__aclitem Oid = 1034
+ T__macaddr Oid = 1040
+ T__inet Oid = 1041
+ T_bpchar Oid = 1042
+ T_varchar Oid = 1043
+ T_date Oid = 1082
+ T_time Oid = 1083
+ T_timestamp Oid = 1114
+ T__timestamp Oid = 1115
+ T__date Oid = 1182
+ T__time Oid = 1183
+ T_timestamptz Oid = 1184
+ T__timestamptz Oid = 1185
+ T_interval Oid = 1186
+ T__interval Oid = 1187
+ T__numeric Oid = 1231
+ T_pg_database Oid = 1248
+ T__cstring Oid = 1263
+ T_timetz Oid = 1266
+ T__timetz Oid = 1270
+ T_bit Oid = 1560
+ T__bit Oid = 1561
+ T_varbit Oid = 1562
+ T__varbit Oid = 1563
+ T_numeric Oid = 1700
+ T_refcursor Oid = 1790
+ T__refcursor Oid = 2201
+ T_regprocedure Oid = 2202
+ T_regoper Oid = 2203
+ T_regoperator Oid = 2204
+ T_regclass Oid = 2205
+ T_regtype Oid = 2206
+ T__regprocedure Oid = 2207
+ T__regoper Oid = 2208
+ T__regoperator Oid = 2209
+ T__regclass Oid = 2210
+ T__regtype Oid = 2211
+ T_record Oid = 2249
+ T_cstring Oid = 2275
+ T_any Oid = 2276
+ T_anyarray Oid = 2277
+ T_void Oid = 2278
+ T_trigger Oid = 2279
+ T_language_handler Oid = 2280
+ T_internal Oid = 2281
+ T_opaque Oid = 2282
+ T_anyelement Oid = 2283
+ T__record Oid = 2287
+ T_anynonarray Oid = 2776
+ T_pg_authid Oid = 2842
+ T_pg_auth_members Oid = 2843
+ T__txid_snapshot Oid = 2949
+ T_uuid Oid = 2950
+ T__uuid Oid = 2951
+ T_txid_snapshot Oid = 2970
+ T_fdw_handler Oid = 3115
+ T_pg_lsn Oid = 3220
+ T__pg_lsn Oid = 3221
+ T_tsm_handler Oid = 3310
+ T_anyenum Oid = 3500
+ T_tsvector Oid = 3614
+ T_tsquery Oid = 3615
+ T_gtsvector Oid = 3642
+ T__tsvector Oid = 3643
+ T__gtsvector Oid = 3644
+ T__tsquery Oid = 3645
+ T_regconfig Oid = 3734
+ T__regconfig Oid = 3735
+ T_regdictionary Oid = 3769
+ T__regdictionary Oid = 3770
+ T_jsonb Oid = 3802
+ T__jsonb Oid = 3807
+ T_anyrange Oid = 3831
+ T_event_trigger Oid = 3838
+ T_int4range Oid = 3904
+ T__int4range Oid = 3905
+ T_numrange Oid = 3906
+ T__numrange Oid = 3907
+ T_tsrange Oid = 3908
+ T__tsrange Oid = 3909
+ T_tstzrange Oid = 3910
+ T__tstzrange Oid = 3911
+ T_daterange Oid = 3912
+ T__daterange Oid = 3913
+ T_int8range Oid = 3926
+ T__int8range Oid = 3927
+ T_pg_shseclabel Oid = 4066
+ T_regnamespace Oid = 4089
+ T__regnamespace Oid = 4090
+ T_regrole Oid = 4096
+ T__regrole Oid = 4097
+)
+
+var TypeName = map[Oid]string{
+ T_bool: "BOOL",
+ T_bytea: "BYTEA",
+ T_char: "CHAR",
+ T_name: "NAME",
+ T_int8: "INT8",
+ T_int2: "INT2",
+ T_int2vector: "INT2VECTOR",
+ T_int4: "INT4",
+ T_regproc: "REGPROC",
+ T_text: "TEXT",
+ T_oid: "OID",
+ T_tid: "TID",
+ T_xid: "XID",
+ T_cid: "CID",
+ T_oidvector: "OIDVECTOR",
+ T_pg_ddl_command: "PG_DDL_COMMAND",
+ T_pg_type: "PG_TYPE",
+ T_pg_attribute: "PG_ATTRIBUTE",
+ T_pg_proc: "PG_PROC",
+ T_pg_class: "PG_CLASS",
+ T_json: "JSON",
+ T_xml: "XML",
+ T__xml: "_XML",
+ T_pg_node_tree: "PG_NODE_TREE",
+ T__json: "_JSON",
+ T_smgr: "SMGR",
+ T_index_am_handler: "INDEX_AM_HANDLER",
+ T_point: "POINT",
+ T_lseg: "LSEG",
+ T_path: "PATH",
+ T_box: "BOX",
+ T_polygon: "POLYGON",
+ T_line: "LINE",
+ T__line: "_LINE",
+ T_cidr: "CIDR",
+ T__cidr: "_CIDR",
+ T_float4: "FLOAT4",
+ T_float8: "FLOAT8",
+ T_abstime: "ABSTIME",
+ T_reltime: "RELTIME",
+ T_tinterval: "TINTERVAL",
+ T_unknown: "UNKNOWN",
+ T_circle: "CIRCLE",
+ T__circle: "_CIRCLE",
+ T_money: "MONEY",
+ T__money: "_MONEY",
+ T_macaddr: "MACADDR",
+ T_inet: "INET",
+ T__bool: "_BOOL",
+ T__bytea: "_BYTEA",
+ T__char: "_CHAR",
+ T__name: "_NAME",
+ T__int2: "_INT2",
+ T__int2vector: "_INT2VECTOR",
+ T__int4: "_INT4",
+ T__regproc: "_REGPROC",
+ T__text: "_TEXT",
+ T__tid: "_TID",
+ T__xid: "_XID",
+ T__cid: "_CID",
+ T__oidvector: "_OIDVECTOR",
+ T__bpchar: "_BPCHAR",
+ T__varchar: "_VARCHAR",
+ T__int8: "_INT8",
+ T__point: "_POINT",
+ T__lseg: "_LSEG",
+ T__path: "_PATH",
+ T__box: "_BOX",
+ T__float4: "_FLOAT4",
+ T__float8: "_FLOAT8",
+ T__abstime: "_ABSTIME",
+ T__reltime: "_RELTIME",
+ T__tinterval: "_TINTERVAL",
+ T__polygon: "_POLYGON",
+ T__oid: "_OID",
+ T_aclitem: "ACLITEM",
+ T__aclitem: "_ACLITEM",
+ T__macaddr: "_MACADDR",
+ T__inet: "_INET",
+ T_bpchar: "BPCHAR",
+ T_varchar: "VARCHAR",
+ T_date: "DATE",
+ T_time: "TIME",
+ T_timestamp: "TIMESTAMP",
+ T__timestamp: "_TIMESTAMP",
+ T__date: "_DATE",
+ T__time: "_TIME",
+ T_timestamptz: "TIMESTAMPTZ",
+ T__timestamptz: "_TIMESTAMPTZ",
+ T_interval: "INTERVAL",
+ T__interval: "_INTERVAL",
+ T__numeric: "_NUMERIC",
+ T_pg_database: "PG_DATABASE",
+ T__cstring: "_CSTRING",
+ T_timetz: "TIMETZ",
+ T__timetz: "_TIMETZ",
+ T_bit: "BIT",
+ T__bit: "_BIT",
+ T_varbit: "VARBIT",
+ T__varbit: "_VARBIT",
+ T_numeric: "NUMERIC",
+ T_refcursor: "REFCURSOR",
+ T__refcursor: "_REFCURSOR",
+ T_regprocedure: "REGPROCEDURE",
+ T_regoper: "REGOPER",
+ T_regoperator: "REGOPERATOR",
+ T_regclass: "REGCLASS",
+ T_regtype: "REGTYPE",
+ T__regprocedure: "_REGPROCEDURE",
+ T__regoper: "_REGOPER",
+ T__regoperator: "_REGOPERATOR",
+ T__regclass: "_REGCLASS",
+ T__regtype: "_REGTYPE",
+ T_record: "RECORD",
+ T_cstring: "CSTRING",
+ T_any: "ANY",
+ T_anyarray: "ANYARRAY",
+ T_void: "VOID",
+ T_trigger: "TRIGGER",
+ T_language_handler: "LANGUAGE_HANDLER",
+ T_internal: "INTERNAL",
+ T_opaque: "OPAQUE",
+ T_anyelement: "ANYELEMENT",
+ T__record: "_RECORD",
+ T_anynonarray: "ANYNONARRAY",
+ T_pg_authid: "PG_AUTHID",
+ T_pg_auth_members: "PG_AUTH_MEMBERS",
+ T__txid_snapshot: "_TXID_SNAPSHOT",
+ T_uuid: "UUID",
+ T__uuid: "_UUID",
+ T_txid_snapshot: "TXID_SNAPSHOT",
+ T_fdw_handler: "FDW_HANDLER",
+ T_pg_lsn: "PG_LSN",
+ T__pg_lsn: "_PG_LSN",
+ T_tsm_handler: "TSM_HANDLER",
+ T_anyenum: "ANYENUM",
+ T_tsvector: "TSVECTOR",
+ T_tsquery: "TSQUERY",
+ T_gtsvector: "GTSVECTOR",
+ T__tsvector: "_TSVECTOR",
+ T__gtsvector: "_GTSVECTOR",
+ T__tsquery: "_TSQUERY",
+ T_regconfig: "REGCONFIG",
+ T__regconfig: "_REGCONFIG",
+ T_regdictionary: "REGDICTIONARY",
+ T__regdictionary: "_REGDICTIONARY",
+ T_jsonb: "JSONB",
+ T__jsonb: "_JSONB",
+ T_anyrange: "ANYRANGE",
+ T_event_trigger: "EVENT_TRIGGER",
+ T_int4range: "INT4RANGE",
+ T__int4range: "_INT4RANGE",
+ T_numrange: "NUMRANGE",
+ T__numrange: "_NUMRANGE",
+ T_tsrange: "TSRANGE",
+ T__tsrange: "_TSRANGE",
+ T_tstzrange: "TSTZRANGE",
+ T__tstzrange: "_TSTZRANGE",
+ T_daterange: "DATERANGE",
+ T__daterange: "_DATERANGE",
+ T_int8range: "INT8RANGE",
+ T__int8range: "_INT8RANGE",
+ T_pg_shseclabel: "PG_SHSECLABEL",
+ T_regnamespace: "REGNAMESPACE",
+ T__regnamespace: "_REGNAMESPACE",
+ T_regrole: "REGROLE",
+ T__regrole: "_REGROLE",
+}
diff --git a/vendor/github.com/lib/pq/pqerror/codes.go b/vendor/github.com/lib/pq/pqerror/codes.go
@@ -0,0 +1,581 @@
+// Code generated by gen.go. DO NOT EDIT.
+
+// Last updated for PostgreSQL 18.3
+
+package pqerror
+
+var (
+ ClassSuccessfulCompletion = Class("00") // Successful Completion
+ ClassWarning = Class("01") // Warning
+ ClassNoData = Class("02") // No Data (this is also a warning class per the SQL standard)
+ ClassSQLStatementNotYetComplete = Class("03") // SQL Statement Not Yet Complete
+ ClassConnectionException = Class("08") // Connection Exception
+ ClassTriggeredActionException = Class("09") // Triggered Action Exception
+ ClassFeatureNotSupported = Class("0A") // Feature Not Supported
+ ClassInvalidTransactionInitiation = Class("0B") // Invalid Transaction Initiation
+ ClassLocatorException = Class("0F") // Locator Exception
+ ClassInvalidGrantor = Class("0L") // Invalid Grantor
+ ClassInvalidRoleSpecification = Class("0P") // Invalid Role Specification
+ ClassDiagnosticsException = Class("0Z") // Diagnostics Exception
+ ClassCaseNotFound = Class("20") // Case Not Found
+ ClassCardinalityViolation = Class("21") // Cardinality Violation
+ ClassDataException = Class("22") // Data Exception
+ ClassIntegrityConstraintViolation = Class("23") // Integrity Constraint Violation
+ ClassInvalidCursorState = Class("24") // Invalid Cursor State
+ ClassInvalidTransactionState = Class("25") // Invalid Transaction State
+ ClassInvalidSQLStatementName = Class("26") // Invalid SQL Statement Name
+ ClassTriggeredDataChangeViolation = Class("27") // Triggered Data Change Violation
+ ClassInvalidAuthorizationSpecification = Class("28") // Invalid Authorization Specification
+ ClassDependentPrivilegeDescriptorsStillExist = Class("2B") // Dependent Privilege Descriptors Still Exist
+ ClassInvalidTransactionTermination = Class("2D") // Invalid Transaction Termination
+ ClassSQLRoutineException = Class("2F") // SQL Routine Exception
+ ClassInvalidCursorName = Class("34") // Invalid Cursor Name
+ ClassExternalRoutineException = Class("38") // External Routine Exception
+ ClassExternalRoutineInvocationException = Class("39") // External Routine Invocation Exception
+ ClassSavepointException = Class("3B") // Savepoint Exception
+ ClassInvalidCatalogName = Class("3D") // Invalid Catalog Name
+ ClassInvalidSchemaName = Class("3F") // Invalid Schema Name
+ ClassTransactionRollback = Class("40") // Transaction Rollback
+ ClassSyntaxErrorOrAccessRuleViolation = Class("42") // Syntax Error or Access Rule Violation
+ ClassWithCheckOptionViolation = Class("44") // WITH CHECK OPTION Violation
+ ClassInsufficientResources = Class("53") // Insufficient Resources
+ ClassProgramLimitExceeded = Class("54") // Program Limit Exceeded
+ ClassObjectNotInPrerequisiteState = Class("55") // Object Not In Prerequisite State
+ ClassOperatorIntervention = Class("57") // Operator Intervention
+ ClassSystemError = Class("58") // System Error (errors external to PostgreSQL itself)
+ ClassConfigFileError = Class("F0") // Configuration File Error
+ ClassFDWError = Class("HV") // Foreign Data Wrapper Error (SQL/MED)
+ ClassPLpgSQLError = Class("P0") // PL/pgSQL Error
+ ClassInternalError = Class("XX") // Internal Error
+)
+
+// A list of all error codes used in PostgreSQL.
+var (
+ SuccessfulCompletion = Code("00000") // Class 00 - Successful Completion
+ Warning = Code("01000") // Class 01 - Warning
+ WarningDynamicResultSetsReturned = Code("0100C")
+ WarningImplicitZeroBitPadding = Code("01008")
+ WarningNullValueEliminatedInSetFunction = Code("01003")
+ WarningPrivilegeNotGranted = Code("01007")
+ WarningPrivilegeNotRevoked = Code("01006")
+ WarningStringDataRightTruncation = Code("01004")
+ WarningDeprecatedFeature = Code("01P01")
+ NoData = Code("02000") // Class 02 - No Data (this is also a warning class per the SQL standard)
+ NoAdditionalDynamicResultSetsReturned = Code("02001")
+ SQLStatementNotYetComplete = Code("03000") // Class 03 - SQL Statement Not Yet Complete
+ ConnectionException = Code("08000") // Class 08 - Connection Exception
+ ConnectionDoesNotExist = Code("08003")
+ ConnectionFailure = Code("08006")
+ SQLClientUnableToEstablishSQLConnection = Code("08001")
+ SQLServerRejectedEstablishmentOfSQLConnection = Code("08004")
+ TransactionResolutionUnknown = Code("08007")
+ ProtocolViolation = Code("08P01")
+ TriggeredActionException = Code("09000") // Class 09 - Triggered Action Exception
+ FeatureNotSupported = Code("0A000") // Class 0A - Feature Not Supported
+ InvalidTransactionInitiation = Code("0B000") // Class 0B - Invalid Transaction Initiation
+ LocatorException = Code("0F000") // Class 0F - Locator Exception
+ LEInvalidSpecification = Code("0F001")
+ InvalidGrantor = Code("0L000") // Class 0L - Invalid Grantor
+ InvalidGrantOperation = Code("0LP01")
+ InvalidRoleSpecification = Code("0P000") // Class 0P - Invalid Role Specification
+ DiagnosticsException = Code("0Z000") // Class 0Z - Diagnostics Exception
+ StackedDiagnosticsAccessedWithoutActiveHandler = Code("0Z002")
+ InvalidArgumentForXquery = Code("10608")
+ CaseNotFound = Code("20000") // Class 20 - Case Not Found
+ CardinalityViolation = Code("21000") // Class 21 - Cardinality Violation
+ DataException = Code("22000") // Class 22 - Data Exception
+ ArraySubscriptError = Code("2202E")
+ CharacterNotInRepertoire = Code("22021")
+ DatetimeFieldOverflow = Code("22008")
+ DivisionByZero = Code("22012")
+ ErrorInAssignment = Code("22005")
+ EscapeCharacterConflict = Code("2200B")
+ IndicatorOverflow = Code("22022")
+ IntervalFieldOverflow = Code("22015")
+ InvalidArgumentForLog = Code("2201E")
+ InvalidArgumentForNtile = Code("22014")
+ InvalidArgumentForNthValue = Code("22016")
+ InvalidArgumentForPowerFunction = Code("2201F")
+ InvalidArgumentForWidthBucketFunction = Code("2201G")
+ InvalidCharacterValueForCast = Code("22018")
+ InvalidDatetimeFormat = Code("22007")
+ InvalidEscapeCharacter = Code("22019")
+ InvalidEscapeOctet = Code("2200D")
+ InvalidEscapeSequence = Code("22025")
+ NonstandardUseOfEscapeCharacter = Code("22P06")
+ InvalidIndicatorParameterValue = Code("22010")
+ InvalidParameterValue = Code("22023")
+ InvalidPrecedingOrFollowingSize = Code("22013")
+ InvalidRegularExpression = Code("2201B")
+ InvalidRowCountInLimitClause = Code("2201W")
+ InvalidRowCountInResultOffsetClause = Code("2201X")
+ InvalidTablesampleArgument = Code("2202H")
+ InvalidTablesampleRepeat = Code("2202G")
+ InvalidTimeZoneDisplacementValue = Code("22009")
+ InvalidUseOfEscapeCharacter = Code("2200C")
+ MostSpecificTypeMismatch = Code("2200G")
+ NullValueNotAllowed = Code("22004")
+ NullValueNoIndicatorParameter = Code("22002")
+ NumericValueOutOfRange = Code("22003")
+ SequenceGeneratorLimitExceeded = Code("2200H")
+ StringDataLengthMismatch = Code("22026")
+ StringDataRightTruncation = Code("22001")
+ SubstringError = Code("22011")
+ TrimError = Code("22027")
+ UnterminatedCString = Code("22024")
+ ZeroLengthCharacterString = Code("2200F")
+ FloatingPointException = Code("22P01")
+ InvalidTextRepresentation = Code("22P02")
+ InvalidBinaryRepresentation = Code("22P03")
+ BadCopyFileFormat = Code("22P04")
+ UntranslatableCharacter = Code("22P05")
+ NotAnXMLDocument = Code("2200L")
+ InvalidXMLDocument = Code("2200M")
+ InvalidXMLContent = Code("2200N")
+ InvalidXMLComment = Code("2200S")
+ InvalidXMLProcessingInstruction = Code("2200T")
+ DuplicateJSONObjectKeyValue = Code("22030")
+ InvalidArgumentForSQLJSONDatetimeFunction = Code("22031")
+ InvalidJSONText = Code("22032")
+ InvalidSQLJSONSubscript = Code("22033")
+ MoreThanOneSQLJSONItem = Code("22034")
+ NoSQLJSONItem = Code("22035")
+ NonNumericSQLJSONItem = Code("22036")
+ NonUniqueKeysInAJSONObject = Code("22037")
+ SingletonSQLJSONItemRequired = Code("22038")
+ SQLJSONArrayNotFound = Code("22039")
+ SQLJSONMemberNotFound = Code("2203A")
+ SQLJSONNumberNotFound = Code("2203B")
+ SQLJSONObjectNotFound = Code("2203C")
+ TooManyJSONArrayElements = Code("2203D")
+ TooManyJSONObjectMembers = Code("2203E")
+ SQLJSONScalarRequired = Code("2203F")
+ SQLJSONItemCannotBeCastToTargetType = Code("2203G")
+ IntegrityConstraintViolation = Code("23000") // Class 23 - Integrity Constraint Violation
+ RestrictViolation = Code("23001")
+ NotNullViolation = Code("23502")
+ ForeignKeyViolation = Code("23503")
+ UniqueViolation = Code("23505")
+ CheckViolation = Code("23514")
+ ExclusionViolation = Code("23P01")
+ InvalidCursorState = Code("24000") // Class 24 - Invalid Cursor State
+ InvalidTransactionState = Code("25000") // Class 25 - Invalid Transaction State
+ ActiveSQLTransaction = Code("25001")
+ BranchTransactionAlreadyActive = Code("25002")
+ HeldCursorRequiresSameIsolationLevel = Code("25008")
+ InappropriateAccessModeForBranchTransaction = Code("25003")
+ InappropriateIsolationLevelForBranchTransaction = Code("25004")
+ NoActiveSQLTransactionForBranchTransaction = Code("25005")
+ ReadOnlySQLTransaction = Code("25006")
+ SchemaAndDataStatementMixingNotSupported = Code("25007")
+ NoActiveSQLTransaction = Code("25P01")
+ InFailedSQLTransaction = Code("25P02")
+ IdleInTransactionSessionTimeout = Code("25P03")
+ TransactionTimeout = Code("25P04")
+ InvalidSQLStatementName = Code("26000") // Class 26 - Invalid SQL Statement Name
+ TriggeredDataChangeViolation = Code("27000") // Class 27 - Triggered Data Change Violation
+ InvalidAuthorizationSpecification = Code("28000") // Class 28 - Invalid Authorization Specification
+ InvalidPassword = Code("28P01")
+ DependentPrivilegeDescriptorsStillExist = Code("2B000") // Class 2B - Dependent Privilege Descriptors Still Exist
+ DependentObjectsStillExist = Code("2BP01")
+ InvalidTransactionTermination = Code("2D000") // Class 2D - Invalid Transaction Termination
+ SQLRoutineException = Code("2F000") // Class 2F - SQL Routine Exception
+ SREFunctionExecutedNoReturnStatement = Code("2F005")
+ SREModifyingSQLDataNotPermitted = Code("2F002")
+ SREProhibitedSQLStatementAttempted = Code("2F003")
+ SREReadingSQLDataNotPermitted = Code("2F004")
+ InvalidCursorName = Code("34000") // Class 34 - Invalid Cursor Name
+ ExternalRoutineException = Code("38000") // Class 38 - External Routine Exception
+ EREContainingSQLNotPermitted = Code("38001")
+ EREModifyingSQLDataNotPermitted = Code("38002")
+ EREProhibitedSQLStatementAttempted = Code("38003")
+ EREReadingSQLDataNotPermitted = Code("38004")
+ ExternalRoutineInvocationException = Code("39000") // Class 39 - External Routine Invocation Exception
+ ERIEInvalidSQLSTATEReturned = Code("39001")
+ ERIENullValueNotAllowed = Code("39004")
+ ERIETriggerProtocolViolated = Code("39P01")
+ ERIESrfProtocolViolated = Code("39P02")
+ ERIEEventTriggerProtocolViolated = Code("39P03")
+ SavepointException = Code("3B000") // Class 3B - Savepoint Exception
+ SEInvalidSpecification = Code("3B001")
+ InvalidCatalogName = Code("3D000") // Class 3D - Invalid Catalog Name
+ InvalidSchemaName = Code("3F000") // Class 3F - Invalid Schema Name
+ TransactionRollback = Code("40000") // Class 40 - Transaction Rollback
+ TRIntegrityConstraintViolation = Code("40002")
+ TRSerializationFailure = Code("40001")
+ TRStatementCompletionUnknown = Code("40003")
+ TRDeadlockDetected = Code("40P01")
+ SyntaxErrorOrAccessRuleViolation = Code("42000") // Class 42 - Syntax Error or Access Rule Violation
+ SyntaxError = Code("42601")
+ InsufficientPrivilege = Code("42501")
+ CannotCoerce = Code("42846")
+ GroupingError = Code("42803")
+ WindowingError = Code("42P20")
+ InvalidRecursion = Code("42P19")
+ InvalidForeignKey = Code("42830")
+ InvalidName = Code("42602")
+ NameTooLong = Code("42622")
+ ReservedName = Code("42939")
+ DatatypeMismatch = Code("42804")
+ IndeterminateDatatype = Code("42P18")
+ CollationMismatch = Code("42P21")
+ IndeterminateCollation = Code("42P22")
+ WrongObjectType = Code("42809")
+ GeneratedAlways = Code("428C9")
+ UndefinedColumn = Code("42703")
+ UndefinedFunction = Code("42883")
+ UndefinedTable = Code("42P01")
+ UndefinedParameter = Code("42P02")
+ UndefinedObject = Code("42704")
+ DuplicateColumn = Code("42701")
+ DuplicateCursor = Code("42P03")
+ DuplicateDatabase = Code("42P04")
+ DuplicateFunction = Code("42723")
+ DuplicatePstatement = Code("42P05")
+ DuplicateSchema = Code("42P06")
+ DuplicateTable = Code("42P07")
+ DuplicateAlias = Code("42712")
+ DuplicateObject = Code("42710")
+ AmbiguousColumn = Code("42702")
+ AmbiguousFunction = Code("42725")
+ AmbiguousParameter = Code("42P08")
+ AmbiguousAlias = Code("42P09")
+ InvalidColumnReference = Code("42P10")
+ InvalidColumnDefinition = Code("42611")
+ InvalidCursorDefinition = Code("42P11")
+ InvalidDatabaseDefinition = Code("42P12")
+ InvalidFunctionDefinition = Code("42P13")
+ InvalidPstatementDefinition = Code("42P14")
+ InvalidSchemaDefinition = Code("42P15")
+ InvalidTableDefinition = Code("42P16")
+ InvalidObjectDefinition = Code("42P17")
+ WithCheckOptionViolation = Code("44000") // Class 44 - WITH CHECK OPTION Violation
+ InsufficientResources = Code("53000") // Class 53 - Insufficient Resources
+ DiskFull = Code("53100")
+ OutOfMemory = Code("53200")
+ TooManyConnections = Code("53300")
+ ConfigurationLimitExceeded = Code("53400")
+ ProgramLimitExceeded = Code("54000") // Class 54 - Program Limit Exceeded
+ StatementTooComplex = Code("54001")
+ TooManyColumns = Code("54011")
+ TooManyArguments = Code("54023")
+ ObjectNotInPrerequisiteState = Code("55000") // Class 55 - Object Not In Prerequisite State
+ ObjectInUse = Code("55006")
+ CantChangeRuntimeParam = Code("55P02")
+ LockNotAvailable = Code("55P03")
+ UnsafeNewEnumValueUsage = Code("55P04")
+ OperatorIntervention = Code("57000") // Class 57 - Operator Intervention
+ QueryCanceled = Code("57014")
+ AdminShutdown = Code("57P01")
+ CrashShutdown = Code("57P02")
+ CannotConnectNow = Code("57P03")
+ DatabaseDropped = Code("57P04")
+ IdleSessionTimeout = Code("57P05")
+ SystemError = Code("58000") // Class 58 - System Error (errors external to PostgreSQL itself)
+ IOError = Code("58030")
+ UndefinedFile = Code("58P01")
+ DuplicateFile = Code("58P02")
+ FileNameTooLong = Code("58P03")
+ ConfigFileError = Code("F0000") // Class F0 - Configuration File Error
+ LockFileExists = Code("F0001")
+ FDWError = Code("HV000") // Class HV - Foreign Data Wrapper Error (SQL/MED)
+ FDWColumnNameNotFound = Code("HV005")
+ FDWDynamicParameterValueNeeded = Code("HV002")
+ FDWFunctionSequenceError = Code("HV010")
+ FDWInconsistentDescriptorInformation = Code("HV021")
+ FDWInvalidAttributeValue = Code("HV024")
+ FDWInvalidColumnName = Code("HV007")
+ FDWInvalidColumnNumber = Code("HV008")
+ FDWInvalidDataType = Code("HV004")
+ FDWInvalidDataTypeDescriptors = Code("HV006")
+ FDWInvalidDescriptorFieldIdentifier = Code("HV091")
+ FDWInvalidHandle = Code("HV00B")
+ FDWInvalidOptionIndex = Code("HV00C")
+ FDWInvalidOptionName = Code("HV00D")
+ FDWInvalidStringLengthOrBufferLength = Code("HV090")
+ FDWInvalidStringFormat = Code("HV00A")
+ FDWInvalidUseOfNullPointer = Code("HV009")
+ FDWTooManyHandles = Code("HV014")
+ FDWOutOfMemory = Code("HV001")
+ FDWNoSchemas = Code("HV00P")
+ FDWOptionNameNotFound = Code("HV00J")
+ FDWReplyHandle = Code("HV00K")
+ FDWSchemaNotFound = Code("HV00Q")
+ FDWTableNotFound = Code("HV00R")
+ FDWUnableToCreateExecution = Code("HV00L")
+ FDWUnableToCreateReply = Code("HV00M")
+ FDWUnableToEstablishConnection = Code("HV00N")
+ PLpgSQLError = Code("P0000") // Class P0 - PL/pgSQL Error
+ RaiseException = Code("P0001")
+ NoDataFound = Code("P0002")
+ TooManyRows = Code("P0003")
+ AssertFailure = Code("P0004")
+ InternalError = Code("XX000") // Class XX - Internal Error
+ DataCorrupted = Code("XX001")
+ IndexCorrupted = Code("XX002")
+)
+
+var errorCodeNames = map[Code]string{
+ "00000": "successful_completion",
+ "01000": "warning",
+ "0100C": "dynamic_result_sets_returned",
+ "01008": "implicit_zero_bit_padding",
+ "01003": "null_value_eliminated_in_set_function",
+ "01007": "privilege_not_granted",
+ "01006": "privilege_not_revoked",
+ "01004": "string_data_right_truncation",
+ "01P01": "deprecated_feature",
+ "02000": "no_data",
+ "02001": "no_additional_dynamic_result_sets_returned",
+ "03000": "sql_statement_not_yet_complete",
+ "08000": "connection_exception",
+ "08003": "connection_does_not_exist",
+ "08006": "connection_failure",
+ "08001": "sqlclient_unable_to_establish_sqlconnection",
+ "08004": "sqlserver_rejected_establishment_of_sqlconnection",
+ "08007": "transaction_resolution_unknown",
+ "08P01": "protocol_violation",
+ "09000": "triggered_action_exception",
+ "0A000": "feature_not_supported",
+ "0B000": "invalid_transaction_initiation",
+ "0F000": "locator_exception",
+ "0F001": "invalid_locator_specification",
+ "0L000": "invalid_grantor",
+ "0LP01": "invalid_grant_operation",
+ "0P000": "invalid_role_specification",
+ "0Z000": "diagnostics_exception",
+ "0Z002": "stacked_diagnostics_accessed_without_active_handler",
+ "10608": "invalid_argument_for_xquery",
+ "20000": "case_not_found",
+ "21000": "cardinality_violation",
+ "22000": "data_exception",
+ "2202E": "array_subscript_error",
+ "22021": "character_not_in_repertoire",
+ "22008": "datetime_field_overflow",
+ "22012": "division_by_zero",
+ "22005": "error_in_assignment",
+ "2200B": "escape_character_conflict",
+ "22022": "indicator_overflow",
+ "22015": "interval_field_overflow",
+ "2201E": "invalid_argument_for_logarithm",
+ "22014": "invalid_argument_for_ntile_function",
+ "22016": "invalid_argument_for_nth_value_function",
+ "2201F": "invalid_argument_for_power_function",
+ "2201G": "invalid_argument_for_width_bucket_function",
+ "22018": "invalid_character_value_for_cast",
+ "22007": "invalid_datetime_format",
+ "22019": "invalid_escape_character",
+ "2200D": "invalid_escape_octet",
+ "22025": "invalid_escape_sequence",
+ "22P06": "nonstandard_use_of_escape_character",
+ "22010": "invalid_indicator_parameter_value",
+ "22023": "invalid_parameter_value",
+ "22013": "invalid_preceding_or_following_size",
+ "2201B": "invalid_regular_expression",
+ "2201W": "invalid_row_count_in_limit_clause",
+ "2201X": "invalid_row_count_in_result_offset_clause",
+ "2202H": "invalid_tablesample_argument",
+ "2202G": "invalid_tablesample_repeat",
+ "22009": "invalid_time_zone_displacement_value",
+ "2200C": "invalid_use_of_escape_character",
+ "2200G": "most_specific_type_mismatch",
+ "22004": "null_value_not_allowed",
+ "22002": "null_value_no_indicator_parameter",
+ "22003": "numeric_value_out_of_range",
+ "2200H": "sequence_generator_limit_exceeded",
+ "22026": "string_data_length_mismatch",
+ "22001": "string_data_right_truncation",
+ "22011": "substring_error",
+ "22027": "trim_error",
+ "22024": "unterminated_c_string",
+ "2200F": "zero_length_character_string",
+ "22P01": "floating_point_exception",
+ "22P02": "invalid_text_representation",
+ "22P03": "invalid_binary_representation",
+ "22P04": "bad_copy_file_format",
+ "22P05": "untranslatable_character",
+ "2200L": "not_an_xml_document",
+ "2200M": "invalid_xml_document",
+ "2200N": "invalid_xml_content",
+ "2200S": "invalid_xml_comment",
+ "2200T": "invalid_xml_processing_instruction",
+ "22030": "duplicate_json_object_key_value",
+ "22031": "invalid_argument_for_sql_json_datetime_function",
+ "22032": "invalid_json_text",
+ "22033": "invalid_sql_json_subscript",
+ "22034": "more_than_one_sql_json_item",
+ "22035": "no_sql_json_item",
+ "22036": "non_numeric_sql_json_item",
+ "22037": "non_unique_keys_in_a_json_object",
+ "22038": "singleton_sql_json_item_required",
+ "22039": "sql_json_array_not_found",
+ "2203A": "sql_json_member_not_found",
+ "2203B": "sql_json_number_not_found",
+ "2203C": "sql_json_object_not_found",
+ "2203D": "too_many_json_array_elements",
+ "2203E": "too_many_json_object_members",
+ "2203F": "sql_json_scalar_required",
+ "2203G": "sql_json_item_cannot_be_cast_to_target_type",
+ "23000": "integrity_constraint_violation",
+ "23001": "restrict_violation",
+ "23502": "not_null_violation",
+ "23503": "foreign_key_violation",
+ "23505": "unique_violation",
+ "23514": "check_violation",
+ "23P01": "exclusion_violation",
+ "24000": "invalid_cursor_state",
+ "25000": "invalid_transaction_state",
+ "25001": "active_sql_transaction",
+ "25002": "branch_transaction_already_active",
+ "25008": "held_cursor_requires_same_isolation_level",
+ "25003": "inappropriate_access_mode_for_branch_transaction",
+ "25004": "inappropriate_isolation_level_for_branch_transaction",
+ "25005": "no_active_sql_transaction_for_branch_transaction",
+ "25006": "read_only_sql_transaction",
+ "25007": "schema_and_data_statement_mixing_not_supported",
+ "25P01": "no_active_sql_transaction",
+ "25P02": "in_failed_sql_transaction",
+ "25P03": "idle_in_transaction_session_timeout",
+ "25P04": "transaction_timeout",
+ "26000": "invalid_sql_statement_name",
+ "27000": "triggered_data_change_violation",
+ "28000": "invalid_authorization_specification",
+ "28P01": "invalid_password",
+ "2B000": "dependent_privilege_descriptors_still_exist",
+ "2BP01": "dependent_objects_still_exist",
+ "2D000": "invalid_transaction_termination",
+ "2F000": "sql_routine_exception",
+ "2F005": "function_executed_no_return_statement",
+ "2F002": "modifying_sql_data_not_permitted",
+ "2F003": "prohibited_sql_statement_attempted",
+ "2F004": "reading_sql_data_not_permitted",
+ "34000": "invalid_cursor_name",
+ "38000": "external_routine_exception",
+ "38001": "containing_sql_not_permitted",
+ "38002": "modifying_sql_data_not_permitted",
+ "38003": "prohibited_sql_statement_attempted",
+ "38004": "reading_sql_data_not_permitted",
+ "39000": "external_routine_invocation_exception",
+ "39001": "invalid_sqlstate_returned",
+ "39004": "null_value_not_allowed",
+ "39P01": "trigger_protocol_violated",
+ "39P02": "srf_protocol_violated",
+ "39P03": "event_trigger_protocol_violated",
+ "3B000": "savepoint_exception",
+ "3B001": "invalid_savepoint_specification",
+ "3D000": "invalid_catalog_name",
+ "3F000": "invalid_schema_name",
+ "40000": "transaction_rollback",
+ "40002": "transaction_integrity_constraint_violation",
+ "40001": "serialization_failure",
+ "40003": "statement_completion_unknown",
+ "40P01": "deadlock_detected",
+ "42000": "syntax_error_or_access_rule_violation",
+ "42601": "syntax_error",
+ "42501": "insufficient_privilege",
+ "42846": "cannot_coerce",
+ "42803": "grouping_error",
+ "42P20": "windowing_error",
+ "42P19": "invalid_recursion",
+ "42830": "invalid_foreign_key",
+ "42602": "invalid_name",
+ "42622": "name_too_long",
+ "42939": "reserved_name",
+ "42804": "datatype_mismatch",
+ "42P18": "indeterminate_datatype",
+ "42P21": "collation_mismatch",
+ "42P22": "indeterminate_collation",
+ "42809": "wrong_object_type",
+ "428C9": "generated_always",
+ "42703": "undefined_column",
+ "42883": "undefined_function",
+ "42P01": "undefined_table",
+ "42P02": "undefined_parameter",
+ "42704": "undefined_object",
+ "42701": "duplicate_column",
+ "42P03": "duplicate_cursor",
+ "42P04": "duplicate_database",
+ "42723": "duplicate_function",
+ "42P05": "duplicate_prepared_statement",
+ "42P06": "duplicate_schema",
+ "42P07": "duplicate_table",
+ "42712": "duplicate_alias",
+ "42710": "duplicate_object",
+ "42702": "ambiguous_column",
+ "42725": "ambiguous_function",
+ "42P08": "ambiguous_parameter",
+ "42P09": "ambiguous_alias",
+ "42P10": "invalid_column_reference",
+ "42611": "invalid_column_definition",
+ "42P11": "invalid_cursor_definition",
+ "42P12": "invalid_database_definition",
+ "42P13": "invalid_function_definition",
+ "42P14": "invalid_prepared_statement_definition",
+ "42P15": "invalid_schema_definition",
+ "42P16": "invalid_table_definition",
+ "42P17": "invalid_object_definition",
+ "44000": "with_check_option_violation",
+ "53000": "insufficient_resources",
+ "53100": "disk_full",
+ "53200": "out_of_memory",
+ "53300": "too_many_connections",
+ "53400": "configuration_limit_exceeded",
+ "54000": "program_limit_exceeded",
+ "54001": "statement_too_complex",
+ "54011": "too_many_columns",
+ "54023": "too_many_arguments",
+ "55000": "object_not_in_prerequisite_state",
+ "55006": "object_in_use",
+ "55P02": "cant_change_runtime_param",
+ "55P03": "lock_not_available",
+ "55P04": "unsafe_new_enum_value_usage",
+ "57000": "operator_intervention",
+ "57014": "query_canceled",
+ "57P01": "admin_shutdown",
+ "57P02": "crash_shutdown",
+ "57P03": "cannot_connect_now",
+ "57P04": "database_dropped",
+ "57P05": "idle_session_timeout",
+ "58000": "system_error",
+ "58030": "io_error",
+ "58P01": "undefined_file",
+ "58P02": "duplicate_file",
+ "58P03": "file_name_too_long",
+ "F0000": "config_file_error",
+ "F0001": "lock_file_exists",
+ "HV000": "fdw_error",
+ "HV005": "fdw_column_name_not_found",
+ "HV002": "fdw_dynamic_parameter_value_needed",
+ "HV010": "fdw_function_sequence_error",
+ "HV021": "fdw_inconsistent_descriptor_information",
+ "HV024": "fdw_invalid_attribute_value",
+ "HV007": "fdw_invalid_column_name",
+ "HV008": "fdw_invalid_column_number",
+ "HV004": "fdw_invalid_data_type",
+ "HV006": "fdw_invalid_data_type_descriptors",
+ "HV091": "fdw_invalid_descriptor_field_identifier",
+ "HV00B": "fdw_invalid_handle",
+ "HV00C": "fdw_invalid_option_index",
+ "HV00D": "fdw_invalid_option_name",
+ "HV090": "fdw_invalid_string_length_or_buffer_length",
+ "HV00A": "fdw_invalid_string_format",
+ "HV009": "fdw_invalid_use_of_null_pointer",
+ "HV014": "fdw_too_many_handles",
+ "HV001": "fdw_out_of_memory",
+ "HV00P": "fdw_no_schemas",
+ "HV00J": "fdw_option_name_not_found",
+ "HV00K": "fdw_reply_handle",
+ "HV00Q": "fdw_schema_not_found",
+ "HV00R": "fdw_table_not_found",
+ "HV00L": "fdw_unable_to_create_execution",
+ "HV00M": "fdw_unable_to_create_reply",
+ "HV00N": "fdw_unable_to_establish_connection",
+ "P0000": "plpgsql_error",
+ "P0001": "raise_exception",
+ "P0002": "no_data_found",
+ "P0003": "too_many_rows",
+ "P0004": "assert_failure",
+ "XX000": "internal_error",
+ "XX001": "data_corrupted",
+ "XX002": "index_corrupted",
+}
diff --git a/vendor/github.com/lib/pq/pqerror/pqerror.go b/vendor/github.com/lib/pq/pqerror/pqerror.go
@@ -0,0 +1,35 @@
+//go:generate go run gen.go
+
+// Package pqerror contains PostgreSQL error codes for use with pq.Error.
+package pqerror
+
+// Code is a five-character error code.
+type Code string
+
+// Name returns a more human friendly rendering of the error code, namely the
+// "condition name".
+func (ec Code) Name() string { return errorCodeNames[ec] }
+
+// Class returns the error class, e.g. "28".
+func (ec Code) Class() Class { return Class(ec[:2]) }
+
+// Class is only the class part of an error code.
+type Class string
+
+// Name returns the condition name of an error class. It is equivalent to the
+// condition name of the "standard" error code (i.e. the one having the last
+// three characters "000").
+func (ec Class) Name() string { return errorCodeNames[Code(ec+"000")] }
+
+// TODO(v2): use "type Severity string" for the below.
+
+// Error severity values.
+const (
+ SeverityFatal = "FATAL"
+ SeverityPanic = "PANIC"
+ SeverityWarning = "WARNING"
+ SeverityNotice = "NOTICE"
+ SeverityDebug = "DEBUG"
+ SeverityInfo = "INFO"
+ SeverityLog = "LOG"
+)
diff --git a/vendor/github.com/lib/pq/quote.go b/vendor/github.com/lib/pq/quote.go
@@ -0,0 +1,71 @@
+package pq
+
+import (
+ "bytes"
+ "strings"
+)
+
+// QuoteIdentifier quotes an "identifier" (e.g. a table or a column name) to be
+// used as part of an SQL statement. For example:
+//
+// tblname := "my_table"
+// data := "my_data"
+// quoted := pq.QuoteIdentifier(tblname)
+// err := db.Exec(fmt.Sprintf("INSERT INTO %s VALUES ($1)", quoted), data)
+//
+// Any double quotes in name will be escaped. The quoted identifier will be case
+// sensitive when used in a query. If the input string contains a zero byte, the
+// result will be truncated immediately before it.
+func QuoteIdentifier(name string) string {
+ end := strings.IndexRune(name, 0)
+ if end > -1 {
+ name = name[:end]
+ }
+ return `"` + strings.Replace(name, `"`, `""`, -1) + `"`
+}
+
+// BufferQuoteIdentifier satisfies the same purpose as QuoteIdentifier, but backed by a
+// byte buffer.
+func BufferQuoteIdentifier(name string, buffer *bytes.Buffer) {
+ // TODO(v2): this should have accepted an io.Writer, not *bytes.Buffer.
+ end := strings.IndexRune(name, 0)
+ if end > -1 {
+ name = name[:end]
+ }
+ buffer.WriteRune('"')
+ buffer.WriteString(strings.Replace(name, `"`, `""`, -1))
+ buffer.WriteRune('"')
+}
+
+// QuoteLiteral quotes a 'literal' (e.g. a parameter, often used to pass literal
+// to DDL and other statements that do not accept parameters) to be used as part
+// of an SQL statement. For example:
+//
+// exp_date := pq.QuoteLiteral("2023-01-05 15:00:00Z")
+// err := db.Exec(fmt.Sprintf("CREATE ROLE my_user VALID UNTIL %s", exp_date))
+//
+// Any single quotes in name will be escaped. Any backslashes (i.e. "\") will be
+// replaced by two backslashes (i.e. "\\") and the C-style escape identifier
+// that PostgreSQL provides ('E') will be prepended to the string.
+func QuoteLiteral(literal string) string {
+ // This follows the PostgreSQL internal algorithm for handling quoted literals
+ // from libpq, which can be found in the "PQEscapeStringInternal" function,
+ // which is found in the libpq/fe-exec.c source file:
+ // https://git.postgresql.org/gitweb/?p=postgresql.git;a=blob;f=src/interfaces/libpq/fe-exec.c
+ //
+ // substitute any single-quotes (') with two single-quotes ('')
+ literal = strings.Replace(literal, `'`, `''`, -1)
+ // determine if the string has any backslashes (\) in it.
+ // if it does, replace any backslashes (\) with two backslashes (\\)
+ // then, we need to wrap the entire string with a PostgreSQL
+ // C-style escape. Per how "PQEscapeStringInternal" handles this case, we
+ // also add a space before the "E"
+ if strings.Contains(literal, `\`) {
+ literal = strings.Replace(literal, `\`, `\\`, -1)
+ literal = ` E'` + literal + `'`
+ } else {
+ // otherwise, we can just wrap the literal with a pair of single quotes
+ literal = `'` + literal + `'`
+ }
+ return literal
+}
diff --git a/vendor/github.com/lib/pq/rows.go b/vendor/github.com/lib/pq/rows.go
@@ -0,0 +1,245 @@
+package pq
+
+import (
+ "database/sql/driver"
+ "fmt"
+ "io"
+ "math"
+ "reflect"
+ "time"
+
+ "github.com/lib/pq/internal/proto"
+ "github.com/lib/pq/oid"
+)
+
+type noRows struct{}
+
+var emptyRows noRows
+
+var _ driver.Result = noRows{}
+
+func (noRows) LastInsertId() (int64, error) { return 0, errNoLastInsertID }
+func (noRows) RowsAffected() (int64, error) { return 0, errNoRowsAffected }
+
+type (
+ rowsHeader struct {
+ colNames []string
+ colTyps []fieldDesc
+ colFmts []format
+ }
+ rows struct {
+ cn *conn
+ finish func()
+ rowsHeader
+ done bool
+ rb readBuf
+ result driver.Result
+ tag string
+
+ next *rowsHeader
+ }
+)
+
+func (rs *rows) Close() error {
+ if finish := rs.finish; finish != nil {
+ defer finish()
+ }
+ // no need to look at cn.bad as Next() will
+ for {
+ err := rs.Next(nil)
+ switch err {
+ case nil:
+ case io.EOF:
+ // rs.Next can return io.EOF on both ReadyForQuery and
+ // RowDescription (used with HasNextResultSet). We need to fetch
+ // messages until we hit a ReadyForQuery, which is done by waiting
+ // for done to be set.
+ if rs.done {
+ return nil
+ }
+ default:
+ return err
+ }
+ }
+}
+
+func (rs *rows) Columns() []string {
+ return rs.colNames
+}
+
+func (rs *rows) Result() driver.Result {
+ if rs.result == nil {
+ return emptyRows
+ }
+ return rs.result
+}
+
+func (rs *rows) Tag() string {
+ return rs.tag
+}
+
+func (rs *rows) Next(dest []driver.Value) (resErr error) {
+ if rs.done {
+ return io.EOF
+ }
+ if err := rs.cn.err.getForNext(); err != nil {
+ return err
+ }
+
+ for {
+ t, err := rs.cn.recv1Buf(&rs.rb)
+ if err != nil {
+ return rs.cn.handleError(err)
+ }
+ switch t {
+ case proto.ErrorResponse:
+ resErr = parseError(&rs.rb, "")
+ case proto.CommandComplete, proto.EmptyQueryResponse:
+ if t == proto.CommandComplete {
+ rs.result, rs.tag, err = rs.cn.parseComplete(rs.rb.string())
+ if err != nil {
+ return rs.cn.handleError(err)
+ }
+ }
+ continue
+ case proto.ReadyForQuery:
+ rs.cn.processReadyForQuery(&rs.rb)
+ rs.done = true
+ if resErr != nil {
+ return rs.cn.handleError(resErr)
+ }
+ return io.EOF
+ case proto.DataRow:
+ n := rs.rb.int16()
+ if resErr != nil {
+ rs.cn.err.set(driver.ErrBadConn)
+ return fmt.Errorf("pq: unexpected DataRow after error %s", resErr)
+ }
+ if n < len(dest) {
+ dest = dest[:n]
+ }
+ for i := range dest {
+ l := rs.rb.int32()
+ if l == -1 {
+ dest[i] = nil
+ continue
+ }
+ dest[i], err = decode(&rs.cn.parameterStatus, rs.rb.next(l), rs.colTyps[i].OID, rs.colFmts[i])
+ if err != nil {
+ return rs.cn.handleError(err)
+ }
+ }
+ return rs.cn.handleError(resErr)
+ case proto.RowDescription:
+ next := parsePortalRowDescribe(&rs.rb)
+ rs.next = &next
+ return io.EOF
+ default:
+ return fmt.Errorf("pq: unexpected message after execute: %q", t)
+ }
+ }
+}
+
+func (rs *rows) HasNextResultSet() bool {
+ hasNext := rs.next != nil && !rs.done
+ return hasNext
+}
+
+func (rs *rows) NextResultSet() error {
+ if rs.next == nil {
+ return io.EOF
+ }
+ rs.rowsHeader = *rs.next
+ rs.next = nil
+ return nil
+}
+
+// ColumnTypeScanType returns the value type that can be used to scan types into.
+func (rs *rows) ColumnTypeScanType(index int) reflect.Type {
+ return rs.colTyps[index].Type()
+}
+
+// ColumnTypeDatabaseTypeName return the database system type name.
+func (rs *rows) ColumnTypeDatabaseTypeName(index int) string {
+ return rs.colTyps[index].Name()
+}
+
+// ColumnTypeLength returns the length of the column type if the column is a
+// variable length type. If the column is not a variable length type ok
+// should return false.
+func (rs *rows) ColumnTypeLength(index int) (length int64, ok bool) {
+ return rs.colTyps[index].Length()
+}
+
+// ColumnTypePrecisionScale should return the precision and scale for decimal
+// types. If not applicable, ok should be false.
+func (rs *rows) ColumnTypePrecisionScale(index int) (precision, scale int64, ok bool) {
+ return rs.colTyps[index].PrecisionScale()
+}
+
+const headerSize = 4
+
+type fieldDesc struct {
+ // The object ID of the data type.
+ OID oid.Oid
+ // The data type size (see pg_type.typlen).
+ // Note that negative values denote variable-width types.
+ Len int
+ // The type modifier (see pg_attribute.atttypmod).
+ // The meaning of the modifier is type-specific.
+ Mod int
+}
+
+func (fd fieldDesc) Type() reflect.Type {
+ switch fd.OID {
+ case oid.T_int8:
+ return reflect.TypeOf(int64(0))
+ case oid.T_int4:
+ return reflect.TypeOf(int32(0))
+ case oid.T_int2:
+ return reflect.TypeOf(int16(0))
+ case oid.T_float8:
+ return reflect.TypeOf(float64(0))
+ case oid.T_float4:
+ return reflect.TypeOf(float32(0))
+ case oid.T_varchar, oid.T_text, oid.T_varbit, oid.T_bit:
+ return reflect.TypeOf("")
+ case oid.T_bool:
+ return reflect.TypeOf(false)
+ case oid.T_date, oid.T_time, oid.T_timetz, oid.T_timestamp, oid.T_timestamptz:
+ return reflect.TypeOf(time.Time{})
+ case oid.T_bytea:
+ return reflect.TypeOf([]byte(nil))
+ default:
+ return reflect.TypeOf(new(any)).Elem()
+ }
+}
+
+func (fd fieldDesc) Name() string {
+ return oid.TypeName[fd.OID]
+}
+
+func (fd fieldDesc) Length() (length int64, ok bool) {
+ switch fd.OID {
+ case oid.T_text, oid.T_bytea:
+ return math.MaxInt64, true
+ case oid.T_varchar, oid.T_bpchar:
+ return int64(fd.Mod - headerSize), true
+ case oid.T_varbit, oid.T_bit:
+ return int64(fd.Mod), true
+ default:
+ return 0, false
+ }
+}
+
+func (fd fieldDesc) PrecisionScale() (precision, scale int64, ok bool) {
+ switch fd.OID {
+ case oid.T_numeric, oid.T__numeric:
+ mod := fd.Mod - headerSize
+ precision = int64((mod >> 16) & 0xffff)
+ scale = int64(mod & 0xffff)
+ return precision, scale, true
+ default:
+ return 0, 0, false
+ }
+}
diff --git a/vendor/github.com/lib/pq/scram/scram.go b/vendor/github.com/lib/pq/scram/scram.go
@@ -0,0 +1,261 @@
+// Copyright (c) 2014 - Gustavo Niemeyer <gustavo@niemeyer.net>
+//
+// All rights reserved.
+//
+// Redistribution and use in source and binary forms, with or without
+// modification, are permitted provided that the following conditions are met:
+//
+// 1. Redistributions of source code must retain the above copyright notice, this
+// list of conditions and the following disclaimer.
+// 2. Redistributions in binary form must reproduce the above copyright notice,
+// this list of conditions and the following disclaimer in the documentation
+// and/or other materials provided with the distribution.
+//
+// THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND
+// ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED
+// WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE
+// DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS BE LIABLE FOR
+// ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES
+// (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES;
+// LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND
+// ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT
+// (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS
+// SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE.
+
+// Package scram implements a SCRAM-{SHA-1,etc} client per RFC5802.
+//
+// http://tools.ietf.org/html/rfc5802
+package scram
+
+import (
+ "bytes"
+ "crypto/hmac"
+ "crypto/rand"
+ "encoding/base64"
+ "fmt"
+ "hash"
+ "strconv"
+ "strings"
+)
+
+// Client implements a SCRAM-* client (SCRAM-SHA-1, SCRAM-SHA-256, etc).
+//
+// A Client may be used within a SASL conversation with logic resembling:
+//
+// var in []byte
+// var client = scram.NewClient(sha1.New, user, pass)
+// for client.Step(in) {
+// out := client.Out()
+// // send out to server
+// in := serverOut
+// }
+// if client.Err() != nil {
+// // auth failed
+// }
+type Client struct {
+ newHash func() hash.Hash
+
+ user string
+ pass string
+ step int
+ out bytes.Buffer
+ err error
+
+ clientNonce []byte
+ serverNonce []byte
+ saltedPass []byte
+ authMsg bytes.Buffer
+}
+
+// NewClient returns a new SCRAM-* client with the provided hash algorithm.
+//
+// For SCRAM-SHA-256, for example, use:
+//
+// client := scram.NewClient(sha256.New, user, pass)
+func NewClient(newHash func() hash.Hash, user, pass string) *Client {
+ c := &Client{
+ newHash: newHash,
+ user: user,
+ pass: pass,
+ }
+ c.out.Grow(256)
+ c.authMsg.Grow(256)
+ return c
+}
+
+// Out returns the data to be sent to the server in the current step.
+func (c *Client) Out() []byte {
+ if c.out.Len() == 0 {
+ return nil
+ }
+ return c.out.Bytes()
+}
+
+// Err returns the error that occurred, or nil if there were no errors.
+func (c *Client) Err() error {
+ return c.err
+}
+
+// SetNonce sets the client nonce to the provided value.
+// If not set, the nonce is generated automatically out of crypto/rand on the first step.
+func (c *Client) SetNonce(nonce []byte) {
+ c.clientNonce = nonce
+}
+
+var escaper = strings.NewReplacer("=", "=3D", ",", "=2C")
+
+// Step processes the incoming data from the server and makes the
+// next round of data for the server available via Client.Out.
+// Step returns false if there are no errors and more data is
+// still expected.
+func (c *Client) Step(in []byte) bool {
+ c.out.Reset()
+ if c.step > 2 || c.err != nil {
+ return false
+ }
+ c.step++
+ switch c.step {
+ case 1:
+ c.err = c.step1(in)
+ case 2:
+ c.err = c.step2(in)
+ case 3:
+ c.err = c.step3(in)
+ }
+ return c.step > 2 || c.err != nil
+}
+
+func (c *Client) step1(in []byte) error {
+ if len(c.clientNonce) == 0 {
+ const nonceLen = 16
+ buf := make([]byte, nonceLen+b64.EncodedLen(nonceLen))
+ if _, err := rand.Read(buf[:nonceLen]); err != nil {
+ return fmt.Errorf("cannot read random SCRAM-SHA-256 nonce from operating system: %w", err)
+ }
+ c.clientNonce = buf[nonceLen:]
+ b64.Encode(c.clientNonce, buf[:nonceLen])
+ }
+ c.authMsg.WriteString("n=")
+ escaper.WriteString(&c.authMsg, c.user)
+ c.authMsg.WriteString(",r=")
+ c.authMsg.Write(c.clientNonce)
+
+ c.out.WriteString("n,,")
+ c.out.Write(c.authMsg.Bytes())
+ return nil
+}
+
+var b64 = base64.StdEncoding
+
+func (c *Client) step2(in []byte) error {
+ c.authMsg.WriteByte(',')
+ c.authMsg.Write(in)
+
+ fields := bytes.Split(in, []byte(","))
+ if len(fields) != 3 {
+ return fmt.Errorf("expected 3 fields in first SCRAM-SHA-256 server message, got %d: %q", len(fields), in)
+ }
+ if !bytes.HasPrefix(fields[0], []byte("r=")) || len(fields[0]) < 2 {
+ return fmt.Errorf("server sent an invalid SCRAM-SHA-256 nonce: %q", fields[0])
+ }
+ if !bytes.HasPrefix(fields[1], []byte("s=")) || len(fields[1]) < 6 {
+ return fmt.Errorf("server sent an invalid SCRAM-SHA-256 salt: %q", fields[1])
+ }
+ if !bytes.HasPrefix(fields[2], []byte("i=")) || len(fields[2]) < 6 {
+ return fmt.Errorf("server sent an invalid SCRAM-SHA-256 iteration count: %q", fields[2])
+ }
+
+ c.serverNonce = fields[0][2:]
+ if !bytes.HasPrefix(c.serverNonce, c.clientNonce) {
+ return fmt.Errorf("server SCRAM-SHA-256 nonce is not prefixed by client nonce: got %q, want %q+\"...\"", c.serverNonce, c.clientNonce)
+ }
+
+ salt := make([]byte, b64.DecodedLen(len(fields[1][2:])))
+ n, err := b64.Decode(salt, fields[1][2:])
+ if err != nil {
+ return fmt.Errorf("cannot decode SCRAM-SHA-256 salt sent by server: %q", fields[1])
+ }
+ salt = salt[:n]
+ iterCount, err := strconv.Atoi(string(fields[2][2:]))
+ if err != nil {
+ return fmt.Errorf("server sent an invalid SCRAM-SHA-256 iteration count: %q", fields[2])
+ }
+ c.saltPassword(salt, iterCount)
+
+ c.authMsg.WriteString(",c=biws,r=")
+ c.authMsg.Write(c.serverNonce)
+
+ c.out.WriteString("c=biws,r=")
+ c.out.Write(c.serverNonce)
+ c.out.WriteString(",p=")
+ c.out.Write(c.clientProof())
+ return nil
+}
+
+func (c *Client) step3(in []byte) error {
+ var isv, ise bool
+ var fields = bytes.Split(in, []byte(","))
+ if len(fields) == 1 {
+ isv = bytes.HasPrefix(fields[0], []byte("v="))
+ ise = bytes.HasPrefix(fields[0], []byte("e="))
+ }
+ if ise {
+ return fmt.Errorf("SCRAM-SHA-256 authentication error: %s", fields[0][2:])
+ } else if !isv {
+ return fmt.Errorf("unsupported SCRAM-SHA-256 final message from server: %q", in)
+ }
+ if !bytes.Equal(c.serverSignature(), fields[0][2:]) {
+ return fmt.Errorf("cannot authenticate SCRAM-SHA-256 server signature: %q", fields[0][2:])
+ }
+ return nil
+}
+
+func (c *Client) saltPassword(salt []byte, iterCount int) {
+ mac := hmac.New(c.newHash, []byte(c.pass))
+ mac.Write(salt)
+ mac.Write([]byte{0, 0, 0, 1})
+ ui := mac.Sum(nil)
+ hi := make([]byte, len(ui))
+ copy(hi, ui)
+ for i := 1; i < iterCount; i++ {
+ mac.Reset()
+ mac.Write(ui)
+ mac.Sum(ui[:0])
+ for j, b := range ui {
+ hi[j] ^= b
+ }
+ }
+ c.saltedPass = hi
+}
+
+func (c *Client) clientProof() []byte {
+ mac := hmac.New(c.newHash, c.saltedPass)
+ mac.Write([]byte("Client Key"))
+ clientKey := mac.Sum(nil)
+ hash := c.newHash()
+ hash.Write(clientKey)
+ storedKey := hash.Sum(nil)
+ mac = hmac.New(c.newHash, storedKey)
+ mac.Write(c.authMsg.Bytes())
+ clientProof := mac.Sum(nil)
+ for i, b := range clientKey {
+ clientProof[i] ^= b
+ }
+ clientProof64 := make([]byte, b64.EncodedLen(len(clientProof)))
+ b64.Encode(clientProof64, clientProof)
+ return clientProof64
+}
+
+func (c *Client) serverSignature() []byte {
+ mac := hmac.New(c.newHash, c.saltedPass)
+ mac.Write([]byte("Server Key"))
+ serverKey := mac.Sum(nil)
+
+ mac = hmac.New(c.newHash, serverKey)
+ mac.Write(c.authMsg.Bytes())
+ serverSignature := mac.Sum(nil)
+
+ encoded := make([]byte, b64.EncodedLen(len(serverSignature)))
+ b64.Encode(encoded, serverSignature)
+ return encoded
+}
diff --git a/vendor/github.com/lib/pq/ssl.go b/vendor/github.com/lib/pq/ssl.go
@@ -0,0 +1,312 @@
+package pq
+
+import (
+ "bytes"
+ "crypto/tls"
+ "crypto/x509"
+ "encoding/pem"
+ "errors"
+ "fmt"
+ "net"
+ "os"
+ "path/filepath"
+ "slices"
+ "strings"
+ "sync"
+
+ "github.com/lib/pq/internal/pqutil"
+)
+
+// Registry for custom tls.Configs
+var (
+ tlsConfs = make(map[string]*tls.Config)
+ tlsConfsMu sync.RWMutex
+)
+
+// RegisterTLSConfig registers a custom [tls.Config]. They are used by using
+// sslmode=pqgo-«key» in the connection string.
+//
+// Set the config to nil to remove a configuration.
+func RegisterTLSConfig(key string, config *tls.Config) error {
+ key = strings.TrimPrefix(key, "pqgo-")
+ if config == nil {
+ tlsConfsMu.Lock()
+ delete(tlsConfs, key)
+ tlsConfsMu.Unlock()
+ return nil
+ }
+
+ tlsConfsMu.Lock()
+ tlsConfs[key] = config
+ tlsConfsMu.Unlock()
+ return nil
+}
+
+func hasTLSConfig(key string) bool {
+ tlsConfsMu.RLock()
+ defer tlsConfsMu.RUnlock()
+ _, ok := tlsConfs[key]
+ return ok
+}
+
+func getTLSConfigClone(key string) *tls.Config {
+ tlsConfsMu.RLock()
+ defer tlsConfsMu.RUnlock()
+ if v, ok := tlsConfs[key]; ok {
+ return v.Clone()
+ }
+ return nil
+}
+
+// ssl generates a function to upgrade a net.Conn based on the "sslmode" and
+// related settings. The function is nil when no upgrade should take place.
+//
+// Don't refer to Config.SSLMode here, as the mode in arguments may be different
+// in case of sslmode=allow or prefer.
+func ssl(cfg Config, mode SSLMode) (func(net.Conn) (net.Conn, error), error) {
+ var (
+ home = pqutil.Home(true)
+ // Don't set defaults here, because tlsConf may be overwritten if a
+ // custom one was registered. Set it after the sslmode switch.
+ tlsConf = &tls.Config{}
+ // Only verify the CA signing but not the hostname.
+ verifyCaOnly = false
+ )
+ if mode.useSSL() && !cfg.SSLInline && cfg.SSLRootCert == "" && home != "" {
+ f := filepath.Join(home, "root.crt")
+ if _, err := os.Stat(f); err == nil {
+ cfg.SSLRootCert = f
+ }
+ }
+ switch {
+ case mode == SSLModeDisable || mode == SSLModeAllow:
+ return nil, nil
+
+ case mode == "" || mode == SSLModeRequire || mode == SSLModePrefer:
+ // Skip TLS's own verification since it requires full verification.
+ tlsConf.InsecureSkipVerify = true
+
+ // From http://www.postgresql.org/docs/current/static/libpq-ssl.html:
+ //
+ // For backwards compatibility with earlier versions of PostgreSQL, if a
+ // root CA file exists, the behavior of sslmode=require will be the same
+ // as that of verify-ca, meaning the server certificate is validated
+ // against the CA. Relying on this behavior is discouraged, and
+ // applications that need certificate validation should always use
+ // verify-ca or verify-full.
+ if cfg.SSLRootCert != "" {
+ if cfg.SSLInline {
+ verifyCaOnly = true
+ } else if _, err := os.Stat(cfg.SSLRootCert); err == nil {
+ verifyCaOnly = true
+ } else if cfg.SSLRootCert != "system" {
+ cfg.SSLRootCert = ""
+ }
+ }
+ case mode == SSLModeVerifyCA:
+ // Skip TLS's own verification since it requires full verification.
+ tlsConf.InsecureSkipVerify = true
+ verifyCaOnly = true
+ case mode == SSLModeVerifyFull:
+ tlsConf.ServerName = cfg.Host
+ case strings.HasPrefix(string(mode), "pqgo-"):
+ tlsConf = getTLSConfigClone(string(mode[5:]))
+ if tlsConf == nil {
+ return nil, fmt.Errorf(`pq: unknown custom sslmode %q`, mode)
+ }
+ default:
+ panic("unreachable")
+ }
+
+ tlsConf.MinVersion = cfg.SSLMinProtocolVersion.tlsconf()
+ tlsConf.MaxVersion = cfg.SSLMaxProtocolVersion.tlsconf()
+
+ // RFC 6066 asks to not set SNI if the host is a literal IP address (IPv4 or
+ // IPv6). This check is coded already crypto.tls.hostnameInSNI, so just
+ // always set ServerName here and let crypto/tls do the filtering.
+ if cfg.SSLSNI {
+ tlsConf.ServerName = cfg.Host
+ }
+
+ err := sslClientCertificates(tlsConf, cfg, home)
+ if err != nil {
+ return nil, err
+ }
+ rootPem, err := sslCertificateAuthority(tlsConf, cfg)
+ if err != nil {
+ return nil, err
+ }
+ sslAppendIntermediates(tlsConf, cfg, rootPem)
+
+ // Accept renegotiation requests initiated by the backend.
+ //
+ // Renegotiation was deprecated then removed from PostgreSQL 9.5, but the
+ // default configuration of older versions has it enabled. Redshift also
+ // initiates renegotiations and cannot be reconfigured.
+ //
+ // TODO: I think this can be removed?
+ tlsConf.Renegotiation = tls.RenegotiateFreelyAsClient
+
+ return func(conn net.Conn) (net.Conn, error) {
+ client := tls.Client(conn, tlsConf)
+ if verifyCaOnly {
+ err := client.Handshake()
+ if err != nil {
+ return client, err
+ }
+ var (
+ certs = client.ConnectionState().PeerCertificates
+ opts = x509.VerifyOptions{Intermediates: x509.NewCertPool(), Roots: tlsConf.RootCAs}
+ )
+ for _, cert := range certs[1:] {
+ opts.Intermediates.AddCert(cert)
+ }
+ _, err = certs[0].Verify(opts)
+ return client, err
+ }
+ return client, nil
+ }, nil
+}
+
+// sslClientCertificates adds the certificate specified in the "sslcert" and
+//
+// "sslkey" settings, or if they aren't set, from the .postgresql directory
+// in the user's home directory. The configured files must exist and have
+// the correct permissions.
+func sslClientCertificates(tlsConf *tls.Config, cfg Config, home string) error {
+ if cfg.SSLInline {
+ cert, err := tls.X509KeyPair([]byte(cfg.SSLCert), []byte(cfg.SSLKey))
+ if err != nil {
+ return err
+ }
+ // Use GetClientCertificate instead of the Certificates field. When
+ // Certificates is set, Go's TLS client only sends the cert if the
+ // server's CertificateRequest includes a CA that issued it. When the
+ // client cert was signed by an intermediate CA but the server only
+ // advertises the root CA, Go skips sending the cert entirely.
+ // GetClientCertificate bypasses this filtering.
+ tlsConf.GetClientCertificate = func(*tls.CertificateRequestInfo) (*tls.Certificate, error) {
+ return &cert, nil
+ }
+ return nil
+ }
+
+ // Only load client certificate and key if the setting is not blank, like libpq.
+ if cfg.SSLCert == "" && home != "" {
+ cfg.SSLCert = filepath.Join(home, "postgresql.crt")
+ }
+ if cfg.SSLCert == "" {
+ return nil
+ }
+ _, err := os.Stat(cfg.SSLCert)
+ if err != nil {
+ if pqutil.ErrNotExists(err) {
+ return nil
+ }
+ return err
+ }
+
+ // In libpq, the ssl key is only loaded if the setting is not blank.
+ if cfg.SSLKey == "" && home != "" {
+ cfg.SSLKey = filepath.Join(home, "postgresql.key")
+ }
+ if cfg.SSLKey != "" {
+ err := pqutil.SSLKeyPermissions(cfg.SSLKey)
+ if err != nil {
+ return err
+ }
+ }
+
+ cert, err := tls.LoadX509KeyPair(cfg.SSLCert, cfg.SSLKey)
+ if err != nil {
+ return err
+ }
+
+ // Using GetClientCertificate instead of Certificates per comment above.
+ tlsConf.GetClientCertificate = func(*tls.CertificateRequestInfo) (*tls.Certificate, error) {
+ return &cert, nil
+ }
+ return nil
+}
+
+var testSystemRoots *x509.CertPool
+
+// sslCertificateAuthority adds the RootCA specified in the "sslrootcert" setting.
+func sslCertificateAuthority(tlsConf *tls.Config, cfg Config) ([]byte, error) {
+ // Only load root certificate if not blank, like libpq.
+ if cfg.SSLRootCert == "" {
+ return nil, nil
+ }
+
+ if cfg.SSLRootCert == "system" {
+ // No work to do as system CAs are used by default if RootCAs is nil.
+ tlsConf.RootCAs = testSystemRoots
+ return nil, nil
+ }
+
+ tlsConf.RootCAs = x509.NewCertPool()
+
+ var cert []byte
+ if cfg.SSLInline {
+ cert = []byte(cfg.SSLRootCert)
+ } else {
+ var err error
+ cert, err = os.ReadFile(cfg.SSLRootCert)
+ if err != nil {
+ return nil, err
+ }
+ }
+
+ if !tlsConf.RootCAs.AppendCertsFromPEM(cert) {
+ return nil, errors.New("pq: couldn't parse pem from sslrootcert")
+ }
+ return cert, nil
+}
+
+// sslAppendIntermediates appends intermediate CA certificates from sslrootcert
+// to the client certificate chain. This is needed so the server can verify the
+// client cert when it was signed by an intermediate CA — without this, the TLS
+// handshake only sends the leaf client cert.
+func sslAppendIntermediates(tlsConf *tls.Config, cfg Config, rootPem []byte) {
+ if cfg.SSLRootCert == "" || tlsConf.GetClientCertificate == nil || len(rootPem) == 0 {
+ return
+ }
+
+ var (
+ pemData = slices.Clone(rootPem)
+ intermediates [][]byte
+ )
+ for {
+ var block *pem.Block
+ block, pemData = pem.Decode(pemData)
+ if block == nil {
+ break
+ }
+ if block.Type != "CERTIFICATE" {
+ continue
+ }
+ cert, err := x509.ParseCertificate(block.Bytes)
+ if err != nil {
+ continue
+ }
+ // Skip self-signed root CAs; only append intermediates.
+ if cert.IsCA && !bytes.Equal(cert.RawIssuer, cert.RawSubject) {
+ intermediates = append(intermediates, block.Bytes)
+ }
+ }
+ if len(intermediates) == 0 {
+ return
+ }
+
+ // Wrap the existing GetClientCertificate to append intermediate certs to
+ // the certificate chain returned during the TLS handshake.
+ origGetCert := tlsConf.GetClientCertificate
+ tlsConf.GetClientCertificate = func(info *tls.CertificateRequestInfo) (*tls.Certificate, error) {
+ cert, err := origGetCert(info)
+ if err != nil {
+ return cert, err
+ }
+ cert.Certificate = append(cert.Certificate, intermediates...)
+ return cert, nil
+ }
+}
diff --git a/vendor/github.com/lib/pq/staticcheck.conf b/vendor/github.com/lib/pq/staticcheck.conf
@@ -0,0 +1,5 @@
+checks = [
+ 'all',
+ '-ST1000', # "Must have at least one package comment"
+ '-ST1003', # "func EnableInfinityTs should be EnableInfinityTS"
+]
diff --git a/vendor/github.com/lib/pq/stmt.go b/vendor/github.com/lib/pq/stmt.go
@@ -0,0 +1,150 @@
+package pq
+
+import (
+ "context"
+ "database/sql/driver"
+ "fmt"
+ "os"
+
+ "github.com/lib/pq/internal/proto"
+ "github.com/lib/pq/oid"
+)
+
+type stmt struct {
+ cn *conn
+ name string
+ rowsHeader
+ colFmtData []byte
+ paramTyps []oid.Oid
+ closed bool
+}
+
+func (st *stmt) Close() error {
+ if st.closed {
+ return nil
+ }
+ if err := st.cn.err.get(); err != nil {
+ return err
+ }
+
+ w := st.cn.writeBuf(proto.Close)
+ w.byte(proto.Sync)
+ w.string(st.name)
+ err := st.cn.send(w)
+ if err != nil {
+ return st.cn.handleError(err)
+ }
+ err = st.cn.send(st.cn.writeBuf(proto.Sync))
+ if err != nil {
+ return st.cn.handleError(err)
+ }
+
+ t, _, err := st.cn.recv1()
+ if err != nil {
+ return st.cn.handleError(err)
+ }
+ if t != proto.CloseComplete {
+ st.cn.err.set(driver.ErrBadConn)
+ return fmt.Errorf("pq: unexpected close response: %q", t)
+ }
+ st.closed = true
+
+ t, r, err := st.cn.recv1()
+ if err != nil {
+ return st.cn.handleError(err)
+ }
+ if t != proto.ReadyForQuery {
+ st.cn.err.set(driver.ErrBadConn)
+ return fmt.Errorf("pq: expected ready for query, but got: %q", t)
+ }
+ st.cn.processReadyForQuery(r)
+
+ return nil
+}
+
+func (st *stmt) Query(v []driver.Value) (r driver.Rows, err error) {
+ return st.query(toNamedValue(v))
+}
+
+func (st *stmt) query(v []driver.NamedValue) (*rows, error) {
+ if err := st.cn.err.get(); err != nil {
+ return nil, err
+ }
+
+ err := st.exec(v)
+ if err != nil {
+ return nil, st.cn.handleError(err)
+ }
+ return &rows{
+ cn: st.cn,
+ rowsHeader: st.rowsHeader,
+ }, nil
+}
+
+func (st *stmt) Exec(v []driver.Value) (driver.Result, error) {
+ return st.ExecContext(context.Background(), toNamedValue(v))
+}
+
+func (st *stmt) exec(v []driver.NamedValue) error {
+ if debugProto {
+ fmt.Fprintf(os.Stderr, " START stmt.exec\n")
+ defer fmt.Fprintf(os.Stderr, " END stmt.exec\n")
+ }
+ if len(v) >= 65536 {
+ return fmt.Errorf("pq: got %d parameters but PostgreSQL only supports 65535 parameters", len(v))
+ }
+ if len(v) != len(st.paramTyps) {
+ return fmt.Errorf("pq: got %d parameters but the statement requires %d", len(v), len(st.paramTyps))
+ }
+
+ cn := st.cn
+ w := cn.writeBuf(proto.Bind)
+ w.byte(0) // unnamed portal
+ w.string(st.name)
+
+ if cn.cfg.BinaryParameters {
+ err := cn.sendBinaryParameters(w, v)
+ if err != nil {
+ return err
+ }
+ } else {
+ w.int16(0)
+ w.int16(len(v))
+ for i, x := range v {
+ if x.Value == nil {
+ w.int32(-1)
+ } else {
+ b, err := encode(x.Value, st.paramTyps[i])
+ if err != nil {
+ return err
+ }
+ if b == nil {
+ w.int32(-1)
+ } else {
+ w.int32(len(b))
+ w.bytes(b)
+ }
+ }
+ }
+ }
+ w.bytes(st.colFmtData)
+
+ w.next(proto.Execute)
+ w.byte(0)
+ w.int32(0)
+
+ w.next(proto.Sync)
+ err := cn.send(w)
+ if err != nil {
+ return err
+ }
+ err = cn.readBindResponse()
+ if err != nil {
+ return err
+ }
+ return cn.postExecuteWorkaround()
+}
+
+func (st *stmt) NumInput() int {
+ return len(st.paramTyps)
+}
diff --git a/vendor/github.com/schanzen/taler-go/LICENSE b/vendor/github.com/schanzen/taler-go/LICENSE
@@ -0,0 +1,661 @@
+ GNU AFFERO GENERAL PUBLIC LICENSE
+ Version 3, 19 November 2007
+
+ Copyright (C) 2007 Free Software Foundation, Inc. <http://fsf.org/>
+ Everyone is permitted to copy and distribute verbatim copies
+ of this license document, but changing it is not allowed.
+
+ Preamble
+
+ The GNU Affero General Public License is a free, copyleft license for
+software and other kinds of works, specifically designed to ensure
+cooperation with the community in the case of network server software.
+
+ The licenses for most software and other practical works are designed
+to take away your freedom to share and change the works. By contrast,
+our General Public Licenses are intended to guarantee your freedom to
+share and change all versions of a program--to make sure it remains free
+software for all its users.
+
+ When we speak of free software, we are referring to freedom, not
+price. Our General Public Licenses are designed to make sure that you
+have the freedom to distribute copies of free software (and charge for
+them if you wish), that you receive source code or can get it if you
+want it, that you can change the software or use pieces of it in new
+free programs, and that you know you can do these things.
+
+ Developers that use our General Public Licenses protect your rights
+with two steps: (1) assert copyright on the software, and (2) offer
+you this License which gives you legal permission to copy, distribute
+and/or modify the software.
+
+ A secondary benefit of defending all users' freedom is that
+improvements made in alternate versions of the program, if they
+receive widespread use, become available for other developers to
+incorporate. Many developers of free software are heartened and
+encouraged by the resulting cooperation. However, in the case of
+software used on network servers, this result may fail to come about.
+The GNU General Public License permits making a modified version and
+letting the public access it on a server without ever releasing its
+source code to the public.
+
+ The GNU Affero General Public License is designed specifically to
+ensure that, in such cases, the modified source code becomes available
+to the community. It requires the operator of a network server to
+provide the source code of the modified version running there to the
+users of that server. Therefore, public use of a modified version, on
+a publicly accessible server, gives the public access to the source
+code of the modified version.
+
+ An older license, called the Affero General Public License and
+published by Affero, was designed to accomplish similar goals. This is
+a different license, not a version of the Affero GPL, but Affero has
+released a new version of the Affero GPL which permits relicensing under
+this license.
+
+ The precise terms and conditions for copying, distribution and
+modification follow.
+
+ TERMS AND CONDITIONS
+
+ 0. Definitions.
+
+ "This License" refers to version 3 of the GNU Affero General Public License.
+
+ "Copyright" also means copyright-like laws that apply to other kinds of
+works, such as semiconductor masks.
+
+ "The Program" refers to any copyrightable work licensed under this
+License. Each licensee is addressed as "you". "Licensees" and
+"recipients" may be individuals or organizations.
+
+ To "modify" a work means to copy from or adapt all or part of the work
+in a fashion requiring copyright permission, other than the making of an
+exact copy. The resulting work is called a "modified version" of the
+earlier work or a work "based on" the earlier work.
+
+ A "covered work" means either the unmodified Program or a work based
+on the Program.
+
+ To "propagate" a work means to do anything with it that, without
+permission, would make you directly or secondarily liable for
+infringement under applicable copyright law, except executing it on a
+computer or modifying a private copy. Propagation includes copying,
+distribution (with or without modification), making available to the
+public, and in some countries other activities as well.
+
+ To "convey" a work means any kind of propagation that enables other
+parties to make or receive copies. Mere interaction with a user through
+a computer network, with no transfer of a copy, is not conveying.
+
+ An interactive user interface displays "Appropriate Legal Notices"
+to the extent that it includes a convenient and prominently visible
+feature that (1) displays an appropriate copyright notice, and (2)
+tells the user that there is no warranty for the work (except to the
+extent that warranties are provided), that licensees may convey the
+work under this License, and how to view a copy of this License. If
+the interface presents a list of user commands or options, such as a
+menu, a prominent item in the list meets this criterion.
+
+ 1. Source Code.
+
+ The "source code" for a work means the preferred form of the work
+for making modifications to it. "Object code" means any non-source
+form of a work.
+
+ A "Standard Interface" means an interface that either is an official
+standard defined by a recognized standards body, or, in the case of
+interfaces specified for a particular programming language, one that
+is widely used among developers working in that language.
+
+ The "System Libraries" of an executable work include anything, other
+than the work as a whole, that (a) is included in the normal form of
+packaging a Major Component, but which is not part of that Major
+Component, and (b) serves only to enable use of the work with that
+Major Component, or to implement a Standard Interface for which an
+implementation is available to the public in source code form. A
+"Major Component", in this context, means a major essential component
+(kernel, window system, and so on) of the specific operating system
+(if any) on which the executable work runs, or a compiler used to
+produce the work, or an object code interpreter used to run it.
+
+ The "Corresponding Source" for a work in object code form means all
+the source code needed to generate, install, and (for an executable
+work) run the object code and to modify the work, including scripts to
+control those activities. However, it does not include the work's
+System Libraries, or general-purpose tools or generally available free
+programs which are used unmodified in performing those activities but
+which are not part of the work. For example, Corresponding Source
+includes interface definition files associated with source files for
+the work, and the source code for shared libraries and dynamically
+linked subprograms that the work is specifically designed to require,
+such as by intimate data communication or control flow between those
+subprograms and other parts of the work.
+
+ The Corresponding Source need not include anything that users
+can regenerate automatically from other parts of the Corresponding
+Source.
+
+ The Corresponding Source for a work in source code form is that
+same work.
+
+ 2. Basic Permissions.
+
+ All rights granted under this License are granted for the term of
+copyright on the Program, and are irrevocable provided the stated
+conditions are met. This License explicitly affirms your unlimited
+permission to run the unmodified Program. The output from running a
+covered work is covered by this License only if the output, given its
+content, constitutes a covered work. This License acknowledges your
+rights of fair use or other equivalent, as provided by copyright law.
+
+ You may make, run and propagate covered works that you do not
+convey, without conditions so long as your license otherwise remains
+in force. You may convey covered works to others for the sole purpose
+of having them make modifications exclusively for you, or provide you
+with facilities for running those works, provided that you comply with
+the terms of this License in conveying all material for which you do
+not control copyright. Those thus making or running the covered works
+for you must do so exclusively on your behalf, under your direction
+and control, on terms that prohibit them from making any copies of
+your copyrighted material outside their relationship with you.
+
+ Conveying under any other circumstances is permitted solely under
+the conditions stated below. Sublicensing is not allowed; section 10
+makes it unnecessary.
+
+ 3. Protecting Users' Legal Rights From Anti-Circumvention Law.
+
+ No covered work shall be deemed part of an effective technological
+measure under any applicable law fulfilling obligations under article
+11 of the WIPO copyright treaty adopted on 20 December 1996, or
+similar laws prohibiting or restricting circumvention of such
+measures.
+
+ When you convey a covered work, you waive any legal power to forbid
+circumvention of technological measures to the extent such circumvention
+is effected by exercising rights under this License with respect to
+the covered work, and you disclaim any intention to limit operation or
+modification of the work as a means of enforcing, against the work's
+users, your or third parties' legal rights to forbid circumvention of
+technological measures.
+
+ 4. Conveying Verbatim Copies.
+
+ You may convey verbatim copies of the Program's source code as you
+receive it, in any medium, provided that you conspicuously and
+appropriately publish on each copy an appropriate copyright notice;
+keep intact all notices stating that this License and any
+non-permissive terms added in accord with section 7 apply to the code;
+keep intact all notices of the absence of any warranty; and give all
+recipients a copy of this License along with the Program.
+
+ You may charge any price or no price for each copy that you convey,
+and you may offer support or warranty protection for a fee.
+
+ 5. Conveying Modified Source Versions.
+
+ You may convey a work based on the Program, or the modifications to
+produce it from the Program, in the form of source code under the
+terms of section 4, provided that you also meet all of these conditions:
+
+ a) The work must carry prominent notices stating that you modified
+ it, and giving a relevant date.
+
+ b) The work must carry prominent notices stating that it is
+ released under this License and any conditions added under section
+ 7. This requirement modifies the requirement in section 4 to
+ "keep intact all notices".
+
+ c) You must license the entire work, as a whole, under this
+ License to anyone who comes into possession of a copy. This
+ License will therefore apply, along with any applicable section 7
+ additional terms, to the whole of the work, and all its parts,
+ regardless of how they are packaged. This License gives no
+ permission to license the work in any other way, but it does not
+ invalidate such permission if you have separately received it.
+
+ d) If the work has interactive user interfaces, each must display
+ Appropriate Legal Notices; however, if the Program has interactive
+ interfaces that do not display Appropriate Legal Notices, your
+ work need not make them do so.
+
+ A compilation of a covered work with other separate and independent
+works, which are not by their nature extensions of the covered work,
+and which are not combined with it such as to form a larger program,
+in or on a volume of a storage or distribution medium, is called an
+"aggregate" if the compilation and its resulting copyright are not
+used to limit the access or legal rights of the compilation's users
+beyond what the individual works permit. Inclusion of a covered work
+in an aggregate does not cause this License to apply to the other
+parts of the aggregate.
+
+ 6. Conveying Non-Source Forms.
+
+ You may convey a covered work in object code form under the terms
+of sections 4 and 5, provided that you also convey the
+machine-readable Corresponding Source under the terms of this License,
+in one of these ways:
+
+ a) Convey the object code in, or embodied in, a physical product
+ (including a physical distribution medium), accompanied by the
+ Corresponding Source fixed on a durable physical medium
+ customarily used for software interchange.
+
+ b) Convey the object code in, or embodied in, a physical product
+ (including a physical distribution medium), accompanied by a
+ written offer, valid for at least three years and valid for as
+ long as you offer spare parts or customer support for that product
+ model, to give anyone who possesses the object code either (1) a
+ copy of the Corresponding Source for all the software in the
+ product that is covered by this License, on a durable physical
+ medium customarily used for software interchange, for a price no
+ more than your reasonable cost of physically performing this
+ conveying of source, or (2) access to copy the
+ Corresponding Source from a network server at no charge.
+
+ c) Convey individual copies of the object code with a copy of the
+ written offer to provide the Corresponding Source. This
+ alternative is allowed only occasionally and noncommercially, and
+ only if you received the object code with such an offer, in accord
+ with subsection 6b.
+
+ d) Convey the object code by offering access from a designated
+ place (gratis or for a charge), and offer equivalent access to the
+ Corresponding Source in the same way through the same place at no
+ further charge. You need not require recipients to copy the
+ Corresponding Source along with the object code. If the place to
+ copy the object code is a network server, the Corresponding Source
+ may be on a different server (operated by you or a third party)
+ that supports equivalent copying facilities, provided you maintain
+ clear directions next to the object code saying where to find the
+ Corresponding Source. Regardless of what server hosts the
+ Corresponding Source, you remain obligated to ensure that it is
+ available for as long as needed to satisfy these requirements.
+
+ e) Convey the object code using peer-to-peer transmission, provided
+ you inform other peers where the object code and Corresponding
+ Source of the work are being offered to the general public at no
+ charge under subsection 6d.
+
+ A separable portion of the object code, whose source code is excluded
+from the Corresponding Source as a System Library, need not be
+included in conveying the object code work.
+
+ A "User Product" is either (1) a "consumer product", which means any
+tangible personal property which is normally used for personal, family,
+or household purposes, or (2) anything designed or sold for incorporation
+into a dwelling. In determining whether a product is a consumer product,
+doubtful cases shall be resolved in favor of coverage. For a particular
+product received by a particular user, "normally used" refers to a
+typical or common use of that class of product, regardless of the status
+of the particular user or of the way in which the particular user
+actually uses, or expects or is expected to use, the product. A product
+is a consumer product regardless of whether the product has substantial
+commercial, industrial or non-consumer uses, unless such uses represent
+the only significant mode of use of the product.
+
+ "Installation Information" for a User Product means any methods,
+procedures, authorization keys, or other information required to install
+and execute modified versions of a covered work in that User Product from
+a modified version of its Corresponding Source. The information must
+suffice to ensure that the continued functioning of the modified object
+code is in no case prevented or interfered with solely because
+modification has been made.
+
+ If you convey an object code work under this section in, or with, or
+specifically for use in, a User Product, and the conveying occurs as
+part of a transaction in which the right of possession and use of the
+User Product is transferred to the recipient in perpetuity or for a
+fixed term (regardless of how the transaction is characterized), the
+Corresponding Source conveyed under this section must be accompanied
+by the Installation Information. But this requirement does not apply
+if neither you nor any third party retains the ability to install
+modified object code on the User Product (for example, the work has
+been installed in ROM).
+
+ The requirement to provide Installation Information does not include a
+requirement to continue to provide support service, warranty, or updates
+for a work that has been modified or installed by the recipient, or for
+the User Product in which it has been modified or installed. Access to a
+network may be denied when the modification itself materially and
+adversely affects the operation of the network or violates the rules and
+protocols for communication across the network.
+
+ Corresponding Source conveyed, and Installation Information provided,
+in accord with this section must be in a format that is publicly
+documented (and with an implementation available to the public in
+source code form), and must require no special password or key for
+unpacking, reading or copying.
+
+ 7. Additional Terms.
+
+ "Additional permissions" are terms that supplement the terms of this
+License by making exceptions from one or more of its conditions.
+Additional permissions that are applicable to the entire Program shall
+be treated as though they were included in this License, to the extent
+that they are valid under applicable law. If additional permissions
+apply only to part of the Program, that part may be used separately
+under those permissions, but the entire Program remains governed by
+this License without regard to the additional permissions.
+
+ When you convey a copy of a covered work, you may at your option
+remove any additional permissions from that copy, or from any part of
+it. (Additional permissions may be written to require their own
+removal in certain cases when you modify the work.) You may place
+additional permissions on material, added by you to a covered work,
+for which you have or can give appropriate copyright permission.
+
+ Notwithstanding any other provision of this License, for material you
+add to a covered work, you may (if authorized by the copyright holders of
+that material) supplement the terms of this License with terms:
+
+ a) Disclaiming warranty or limiting liability differently from the
+ terms of sections 15 and 16 of this License; or
+
+ b) Requiring preservation of specified reasonable legal notices or
+ author attributions in that material or in the Appropriate Legal
+ Notices displayed by works containing it; or
+
+ c) Prohibiting misrepresentation of the origin of that material, or
+ requiring that modified versions of such material be marked in
+ reasonable ways as different from the original version; or
+
+ d) Limiting the use for publicity purposes of names of licensors or
+ authors of the material; or
+
+ e) Declining to grant rights under trademark law for use of some
+ trade names, trademarks, or service marks; or
+
+ f) Requiring indemnification of licensors and authors of that
+ material by anyone who conveys the material (or modified versions of
+ it) with contractual assumptions of liability to the recipient, for
+ any liability that these contractual assumptions directly impose on
+ those licensors and authors.
+
+ All other non-permissive additional terms are considered "further
+restrictions" within the meaning of section 10. If the Program as you
+received it, or any part of it, contains a notice stating that it is
+governed by this License along with a term that is a further
+restriction, you may remove that term. If a license document contains
+a further restriction but permits relicensing or conveying under this
+License, you may add to a covered work material governed by the terms
+of that license document, provided that the further restriction does
+not survive such relicensing or conveying.
+
+ If you add terms to a covered work in accord with this section, you
+must place, in the relevant source files, a statement of the
+additional terms that apply to those files, or a notice indicating
+where to find the applicable terms.
+
+ Additional terms, permissive or non-permissive, may be stated in the
+form of a separately written license, or stated as exceptions;
+the above requirements apply either way.
+
+ 8. Termination.
+
+ You may not propagate or modify a covered work except as expressly
+provided under this License. Any attempt otherwise to propagate or
+modify it is void, and will automatically terminate your rights under
+this License (including any patent licenses granted under the third
+paragraph of section 11).
+
+ However, if you cease all violation of this License, then your
+license from a particular copyright holder is reinstated (a)
+provisionally, unless and until the copyright holder explicitly and
+finally terminates your license, and (b) permanently, if the copyright
+holder fails to notify you of the violation by some reasonable means
+prior to 60 days after the cessation.
+
+ Moreover, your license from a particular copyright holder is
+reinstated permanently if the copyright holder notifies you of the
+violation by some reasonable means, this is the first time you have
+received notice of violation of this License (for any work) from that
+copyright holder, and you cure the violation prior to 30 days after
+your receipt of the notice.
+
+ Termination of your rights under this section does not terminate the
+licenses of parties who have received copies or rights from you under
+this License. If your rights have been terminated and not permanently
+reinstated, you do not qualify to receive new licenses for the same
+material under section 10.
+
+ 9. Acceptance Not Required for Having Copies.
+
+ You are not required to accept this License in order to receive or
+run a copy of the Program. Ancillary propagation of a covered work
+occurring solely as a consequence of using peer-to-peer transmission
+to receive a copy likewise does not require acceptance. However,
+nothing other than this License grants you permission to propagate or
+modify any covered work. These actions infringe copyright if you do
+not accept this License. Therefore, by modifying or propagating a
+covered work, you indicate your acceptance of this License to do so.
+
+ 10. Automatic Licensing of Downstream Recipients.
+
+ Each time you convey a covered work, the recipient automatically
+receives a license from the original licensors, to run, modify and
+propagate that work, subject to this License. You are not responsible
+for enforcing compliance by third parties with this License.
+
+ An "entity transaction" is a transaction transferring control of an
+organization, or substantially all assets of one, or subdividing an
+organization, or merging organizations. If propagation of a covered
+work results from an entity transaction, each party to that
+transaction who receives a copy of the work also receives whatever
+licenses to the work the party's predecessor in interest had or could
+give under the previous paragraph, plus a right to possession of the
+Corresponding Source of the work from the predecessor in interest, if
+the predecessor has it or can get it with reasonable efforts.
+
+ You may not impose any further restrictions on the exercise of the
+rights granted or affirmed under this License. For example, you may
+not impose a license fee, royalty, or other charge for exercise of
+rights granted under this License, and you may not initiate litigation
+(including a cross-claim or counterclaim in a lawsuit) alleging that
+any patent claim is infringed by making, using, selling, offering for
+sale, or importing the Program or any portion of it.
+
+ 11. Patents.
+
+ A "contributor" is a copyright holder who authorizes use under this
+License of the Program or a work on which the Program is based. The
+work thus licensed is called the contributor's "contributor version".
+
+ A contributor's "essential patent claims" are all patent claims
+owned or controlled by the contributor, whether already acquired or
+hereafter acquired, that would be infringed by some manner, permitted
+by this License, of making, using, or selling its contributor version,
+but do not include claims that would be infringed only as a
+consequence of further modification of the contributor version. For
+purposes of this definition, "control" includes the right to grant
+patent sublicenses in a manner consistent with the requirements of
+this License.
+
+ Each contributor grants you a non-exclusive, worldwide, royalty-free
+patent license under the contributor's essential patent claims, to
+make, use, sell, offer for sale, import and otherwise run, modify and
+propagate the contents of its contributor version.
+
+ In the following three paragraphs, a "patent license" is any express
+agreement or commitment, however denominated, not to enforce a patent
+(such as an express permission to practice a patent or covenant not to
+sue for patent infringement). To "grant" such a patent license to a
+party means to make such an agreement or commitment not to enforce a
+patent against the party.
+
+ If you convey a covered work, knowingly relying on a patent license,
+and the Corresponding Source of the work is not available for anyone
+to copy, free of charge and under the terms of this License, through a
+publicly available network server or other readily accessible means,
+then you must either (1) cause the Corresponding Source to be so
+available, or (2) arrange to deprive yourself of the benefit of the
+patent license for this particular work, or (3) arrange, in a manner
+consistent with the requirements of this License, to extend the patent
+license to downstream recipients. "Knowingly relying" means you have
+actual knowledge that, but for the patent license, your conveying the
+covered work in a country, or your recipient's use of the covered work
+in a country, would infringe one or more identifiable patents in that
+country that you have reason to believe are valid.
+
+ If, pursuant to or in connection with a single transaction or
+arrangement, you convey, or propagate by procuring conveyance of, a
+covered work, and grant a patent license to some of the parties
+receiving the covered work authorizing them to use, propagate, modify
+or convey a specific copy of the covered work, then the patent license
+you grant is automatically extended to all recipients of the covered
+work and works based on it.
+
+ A patent license is "discriminatory" if it does not include within
+the scope of its coverage, prohibits the exercise of, or is
+conditioned on the non-exercise of one or more of the rights that are
+specifically granted under this License. You may not convey a covered
+work if you are a party to an arrangement with a third party that is
+in the business of distributing software, under which you make payment
+to the third party based on the extent of your activity of conveying
+the work, and under which the third party grants, to any of the
+parties who would receive the covered work from you, a discriminatory
+patent license (a) in connection with copies of the covered work
+conveyed by you (or copies made from those copies), or (b) primarily
+for and in connection with specific products or compilations that
+contain the covered work, unless you entered into that arrangement,
+or that patent license was granted, prior to 28 March 2007.
+
+ Nothing in this License shall be construed as excluding or limiting
+any implied license or other defenses to infringement that may
+otherwise be available to you under applicable patent law.
+
+ 12. No Surrender of Others' Freedom.
+
+ If conditions are imposed on you (whether by court order, agreement or
+otherwise) that contradict the conditions of this License, they do not
+excuse you from the conditions of this License. If you cannot convey a
+covered work so as to satisfy simultaneously your obligations under this
+License and any other pertinent obligations, then as a consequence you may
+not convey it at all. For example, if you agree to terms that obligate you
+to collect a royalty for further conveying from those to whom you convey
+the Program, the only way you could satisfy both those terms and this
+License would be to refrain entirely from conveying the Program.
+
+ 13. Remote Network Interaction; Use with the GNU General Public License.
+
+ Notwithstanding any other provision of this License, if you modify the
+Program, your modified version must prominently offer all users
+interacting with it remotely through a computer network (if your version
+supports such interaction) an opportunity to receive the Corresponding
+Source of your version by providing access to the Corresponding Source
+from a network server at no charge, through some standard or customary
+means of facilitating copying of software. This Corresponding Source
+shall include the Corresponding Source for any work covered by version 3
+of the GNU General Public License that is incorporated pursuant to the
+following paragraph.
+
+ Notwithstanding any other provision of this License, you have
+permission to link or combine any covered work with a work licensed
+under version 3 of the GNU General Public License into a single
+combined work, and to convey the resulting work. The terms of this
+License will continue to apply to the part which is the covered work,
+but the work with which it is combined will remain governed by version
+3 of the GNU General Public License.
+
+ 14. Revised Versions of this License.
+
+ The Free Software Foundation may publish revised and/or new versions of
+the GNU Affero General Public License from time to time. Such new versions
+will be similar in spirit to the present version, but may differ in detail to
+address new problems or concerns.
+
+ Each version is given a distinguishing version number. If the
+Program specifies that a certain numbered version of the GNU Affero General
+Public License "or any later version" applies to it, you have the
+option of following the terms and conditions either of that numbered
+version or of any later version published by the Free Software
+Foundation. If the Program does not specify a version number of the
+GNU Affero General Public License, you may choose any version ever published
+by the Free Software Foundation.
+
+ If the Program specifies that a proxy can decide which future
+versions of the GNU Affero General Public License can be used, that proxy's
+public statement of acceptance of a version permanently authorizes you
+to choose that version for the Program.
+
+ Later license versions may give you additional or different
+permissions. However, no additional obligations are imposed on any
+author or copyright holder as a result of your choosing to follow a
+later version.
+
+ 15. Disclaimer of Warranty.
+
+ THERE IS NO WARRANTY FOR THE PROGRAM, TO THE EXTENT PERMITTED BY
+APPLICABLE LAW. EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT
+HOLDERS AND/OR OTHER PARTIES PROVIDE THE PROGRAM "AS IS" WITHOUT WARRANTY
+OF ANY KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO,
+THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR
+PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE PROGRAM
+IS WITH YOU. SHOULD THE PROGRAM PROVE DEFECTIVE, YOU ASSUME THE COST OF
+ALL NECESSARY SERVICING, REPAIR OR CORRECTION.
+
+ 16. Limitation of Liability.
+
+ IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING
+WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MODIFIES AND/OR CONVEYS
+THE PROGRAM AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES, INCLUDING ANY
+GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE
+USE OR INABILITY TO USE THE PROGRAM (INCLUDING BUT NOT LIMITED TO LOSS OF
+DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD
+PARTIES OR A FAILURE OF THE PROGRAM TO OPERATE WITH ANY OTHER PROGRAMS),
+EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF
+SUCH DAMAGES.
+
+ 17. Interpretation of Sections 15 and 16.
+
+ If the disclaimer of warranty and limitation of liability provided
+above cannot be given local legal effect according to their terms,
+reviewing courts shall apply local law that most closely approximates
+an absolute waiver of all civil liability in connection with the
+Program, unless a warranty or assumption of liability accompanies a
+copy of the Program in return for a fee.
+
+ END OF TERMS AND CONDITIONS
+
+ How to Apply These Terms to Your New Programs
+
+ If you develop a new program, and you want it to be of the greatest
+possible use to the public, the best way to achieve this is to make it
+free software which everyone can redistribute and change under these terms.
+
+ To do so, attach the following notices to the program. It is safest
+to attach them to the start of each source file to most effectively
+state the exclusion of warranty; and each file should have at least
+the "copyright" line and a pointer to where the full notice is found.
+
+ <one line to give the program's name and a brief idea of what it does.>
+ Copyright (C) <year> <name of author>
+
+ This program is free software: you can redistribute it and/or modify
+ it under the terms of the GNU Affero General Public License as published
+ by the Free Software Foundation, either version 3 of the License, or
+ (at your option) any later version.
+
+ This program is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
+ GNU Affero General Public License for more details.
+
+ You should have received a copy of the GNU Affero General Public License
+ along with this program. If not, see <http://www.gnu.org/licenses/>.
+
+Also add information on how to contact you by electronic and paper mail.
+
+ If your software can interact with users remotely through a computer
+network, you should also make sure that it provides a way for users to
+get its source. For example, if your program is a web application, its
+interface could display a "Source" link that leads users to an archive
+of the code. There are many ways you could offer source, and different
+solutions will be better for different programs; see section 13 for the
+specific requirements.
+
+ You should also get your employer (if you work as a programmer) or school,
+if any, to sign a "copyright disclaimer" for the program, if necessary.
+For more information on this, and how to apply and follow the GNU AGPL, see
+<http://www.gnu.org/licenses/>.
diff --git a/vendor/github.com/schanzen/taler-go/pkg/merchant/merchant.go b/vendor/github.com/schanzen/taler-go/pkg/merchant/merchant.go
@@ -0,0 +1,327 @@
+package merchant
+
+import (
+ "bytes"
+ "encoding/json"
+ "errors"
+ "fmt"
+ "io"
+ "net/http"
+
+ "github.com/schanzen/taler-go/pkg/util"
+)
+
+type MerchantConfig struct {
+ // Default currency
+ Currency string `json:"currency"`
+
+ // Supported currencies
+ Currencies map[string]util.CurrencySpecification `json:"currencies"`
+
+ // Name
+ Name string `json:"name"`
+
+ // Version string
+ Version string `json:"version"`
+}
+
+type PostOrderRequest struct {
+ // The order must at least contain the minimal
+ // order detail, but can override all.
+ Order CommonOrder `json:"order"`
+
+ // If set, the backend will then set the refund deadline to the current
+ // time plus the specified delay. If it's not set, refunds will not be
+ // possible.
+ RefundDelay int64 `json:"refund_delay,omitempty"`
+
+ // Specifies the payment target preferred by the client. Can be used
+ // to select among the various (active) wire methods supported by the instance.
+ PaymentTarget string `json:"payment_target,omitempty"`
+
+ // Specifies that some products are to be included in the
+ // order from the inventory. For these inventory management
+ // is performed (so the products must be in stock) and
+ // details are completed from the product data of the backend.
+ // FIXME: Not sure we actually need this for now
+ //InventoryProducts []MinimalInventoryProduct `json:"inventory_products,omitempty"`
+
+ // Specifies a lock identifier that was used to
+ // lock a product in the inventory. Only useful if
+ // inventory_products is set. Used in case a frontend
+ // reserved quantities of the individual products while
+ // the shopping cart was being built. Multiple UUIDs can
+ // be used in case different UUIDs were used for different
+ // products (i.e. in case the user started with multiple
+ // shopping sessions that were combined during checkout).
+ LockUuids []string `json:"lock_uuids,omitempty"`
+
+ // Should a token for claiming the order be generated?
+ // False can make sense if the ORDER_ID is sufficiently
+ // high entropy to prevent adversarial claims (like it is
+ // if the backend auto-generates one). Default is 'true'.
+ CreateToken bool `json:"create_token,omitempty"`
+}
+
+type CommonOrder struct {
+ // Total price for the transaction. The exchange will subtract deposit
+ // fees from that amount before transferring it to the merchant.
+ Amount string `json:"amount"`
+
+ // Maximum total deposit fee accepted by the merchant for this contract.
+ // Overrides defaults of the merchant instance.
+ MaxFee string `json:"max_fee,omitempty"`
+
+ // Human-readable description of the whole purchase.
+ Summary string `json:"summary"`
+
+ // Map from IETF BCP 47 language tags to localized summaries.
+ SummaryI18n string `json:"summary_i18n,omitempty"`
+
+ // Unique identifier for the order. Only characters
+ // allowed are "A-Za-z0-9" and ".:_-".
+ // Must be unique within a merchant instance.
+ // For merchants that do not store proposals in their DB
+ // before the customer paid for them, the order_id can be used
+ // by the frontend to restore a proposal from the information
+ // encoded in it (such as a short product identifier and timestamp).
+ OrderId string `json:"order_id,omitempty"`
+
+ // URL where the same contract could be ordered again (if
+ // available). Returned also at the public order endpoint
+ // for people other than the actual buyer (hence public,
+ // in case order IDs are guessable).
+ PublicReorderUrl string `json:"public_reorder_url,omitempty"`
+
+ // See documentation of fulfillment_url field in ContractTerms.
+ // Either fulfillment_url or fulfillment_message must be specified.
+ // When creating an order, the fulfillment URL can
+ // contain ${ORDER_ID} which will be substituted with the
+ // order ID of the newly created order.
+ FulfillmentUrl string `json:"fulfillment_url,omitempty"`
+
+ // See documentation of fulfillment_message in ContractTerms.
+ // Either fulfillment_url or fulfillment_message must be specified.
+ FulfillmentMessage string `json:"fulfillment_message,omitempty"`
+
+ // Map from IETF BCP 47 language tags to localized fulfillment
+ // messages.
+ FulfillmentMessageI18n string `json:"fulfillment_message_i18n,omitempty"`
+
+ // Minimum age the buyer must have to buy.
+ MinimumAge *uint64 `json:"minimum_age,omitempty"`
+
+ // List of products that are part of the purchase.
+ //products?: Product[];
+
+ // Time when this contract was generated. If null, defaults to current
+ // time of merchant backend.
+ Timestamp *uint64 `json:"timestamp,omitempty"`
+
+ // After this deadline has passed, no refunds will be accepted.
+ // Overrides deadline calculated from refund_delay in
+ // PostOrderRequest.
+ RefundDeadline *uint64 `json:"refund_deadline,omitempty"`
+
+ // After this deadline, the merchant won't accept payments for the contract.
+ // Overrides deadline calculated from default pay delay configured in
+ // merchant backend.
+ PayDeadline *uint64 `json:"pay_deadline,omitempty"`
+
+ // Transfer deadline for the exchange. Must be in the deposit permissions
+ // of coins used to pay for this order.
+ // Overrides deadline calculated from default wire transfer delay
+ // configured in merchant backend. Must be after refund deadline.
+ WireTransferDeadline *uint64 `json:"wire_transfer_deadline,omitempty"`
+
+ // Base URL of the (public!) merchant backend API.
+ // Must be an absolute URL that ends with a slash.
+ // Defaults to the base URL this request was made to.
+ MerchantBaseUrl string `json:"merchant_base_url,omitempty"`
+
+ // Delivery location for (all!) products.
+ //DeliveryLocation?: Location;
+
+ // Time indicating when the order should be delivered.
+ // May be overwritten by individual products.
+ // Must be in the future.
+ DeliveryDate *uint64 `json:"delivery_deadline,omitempty"`
+
+ // See documentation of auto_refund in ContractTerms.
+ // Specifies for how long the wallet should try to get an
+ // automatic refund for the purchase.
+ AutoRefund *uint64 `json:"auto_refund,omitempty"`
+
+ // Extra data that is only interpreted by the merchant frontend.
+ // Useful when the merchant needs to store extra information on a
+ // contract without storing it separately in their database.
+ // Must really be an Object (not a string, integer, float or array).
+ Extra string
+}
+
+// NOTE: Part of the above but optional
+type FulfillmentMetadata struct {
+ // See documentation of fulfillment_url in ContractTerms.
+ // Either fulfillment_url or fulfillment_message must be specified.
+ FulfillmentUrl string `json:"fulfillment_url,omitempty"`
+
+ // See documentation of fulfillment_message in ContractTerms.
+ // Either fulfillment_url or fulfillment_message must be specified.
+ FulfillmentMessage string `json:"fulfillment_message,omitempty"`
+}
+
+type PostOrderResponse struct {
+ // Order ID of the response that was just created.
+ OrderId string `json:"order_id"`
+}
+
+type PostOrderResponseToken struct {
+ // Token that authorizes the wallet to claim the order.
+ // Provided only if "create_token" was set to 'true'
+ // in the request.
+ Token string
+}
+
+type CheckPaymentStatusResponse struct {
+ // Status of the order
+ OrderStatus string `json:"order_status"`
+}
+
+type CheckPaymentPaytoResponse struct {
+ // Status of the order
+ TalerPayUri string `json:"taler_pay_uri"`
+}
+
+type Merchant struct {
+
+ // The host of this merchant
+ BaseUrlPrivate string
+
+ // The access token to use for the private API
+ AccessToken string
+}
+
+func NewMerchant(merchBaseUrlPrivate string, merchAccessToken string) Merchant {
+ return Merchant{
+ BaseUrlPrivate: merchBaseUrlPrivate,
+ AccessToken: merchAccessToken,
+ }
+}
+
+type PaymentStatus string
+
+const (
+ OrderStatusUnknown = ""
+ OrderPaid = "paid"
+ OrderUnpaid = "unpaid"
+ OrderClaimed = "claimed"
+)
+
+func (m *Merchant) IsOrderPaid(orderId string) (int, PaymentStatus, string, error) {
+ var orderPaidResponse CheckPaymentStatusResponse
+ var paytoResponse CheckPaymentPaytoResponse
+ client := &http.Client{}
+ req, _ := http.NewRequest("GET", m.BaseUrlPrivate+"/private/orders/"+orderId, nil)
+ req.Header.Set("Authorization", "Bearer secret-token:"+m.AccessToken)
+ resp, err := client.Do(req)
+ if nil != err {
+ return resp.StatusCode, OrderStatusUnknown, "", err
+ }
+ defer resp.Body.Close()
+ if http.StatusOK != resp.StatusCode {
+ message := fmt.Sprintf("Expected response code %d. Got %d", http.StatusOK, resp.StatusCode)
+ return resp.StatusCode, OrderStatusUnknown, "", errors.New(message)
+ }
+ respData, err := io.ReadAll(resp.Body)
+ if err != nil {
+ return resp.StatusCode, OrderStatusUnknown, "", err
+ }
+ err = json.NewDecoder(bytes.NewReader(respData)).Decode(&orderPaidResponse)
+ if err != nil {
+ return resp.StatusCode, OrderStatusUnknown, "", err
+ }
+ if orderPaidResponse.OrderStatus == "unpaid" {
+ err = json.NewDecoder(bytes.NewReader(respData)).Decode(&paytoResponse)
+ return resp.StatusCode, PaymentStatus(orderPaidResponse.OrderStatus), paytoResponse.TalerPayUri, err
+ }
+ return resp.StatusCode, PaymentStatus(orderPaidResponse.OrderStatus), "", nil
+}
+
+func (m *Merchant) GetConfig() (*MerchantConfig, error) {
+ var configResponse MerchantConfig
+ client := &http.Client{}
+ req, _ := http.NewRequest("GET", m.BaseUrlPrivate+"/config", nil)
+ resp, err := client.Do(req)
+ if nil != err {
+ return nil, err
+ }
+ defer resp.Body.Close()
+ if http.StatusOK != resp.StatusCode {
+ message := fmt.Sprintf("Expected response code %d. Got %d", http.StatusOK, resp.StatusCode)
+ return nil, errors.New(message)
+ }
+ respData, err := io.ReadAll(resp.Body)
+ if err != nil {
+ return nil, err
+ }
+ err = json.NewDecoder(bytes.NewReader(respData)).Decode(&configResponse)
+ if err != nil {
+ return nil, err
+ }
+ return &configResponse, nil
+}
+
+func (m *Merchant) CreateOrder(order CommonOrder) (string, error) {
+ var newOrder PostOrderRequest
+ var orderResponse PostOrderResponse
+ newOrder.Order = order
+ reqString, err := json.Marshal(newOrder)
+ if nil != err {
+ return "", err
+ }
+ client := &http.Client{}
+ req, _ := http.NewRequest(http.MethodPost, m.BaseUrlPrivate+"/private/orders", bytes.NewReader(reqString))
+ req.Header.Set("Authorization", "Bearer secret-token:"+m.AccessToken)
+ resp, err := client.Do(req)
+
+ if nil != err {
+ return "", err
+ }
+ defer resp.Body.Close()
+ if http.StatusOK != resp.StatusCode {
+ message := fmt.Sprintf("Expected response code %d. Got %d. With request %s", http.StatusOK, resp.StatusCode, reqString)
+ return "", errors.New(message)
+ }
+ err = json.NewDecoder(resp.Body).Decode(&orderResponse)
+ return orderResponse.OrderId, err
+}
+
+func (m *Merchant) AddNewOrder(cost util.Amount, summary string, fulfillment_url string) (string, error) {
+ var newOrder PostOrderRequest
+ var orderDetail CommonOrder
+ var orderResponse PostOrderResponse
+ orderDetail.Amount = cost.String()
+ // FIXME get from cfg
+ orderDetail.Summary = summary
+ orderDetail.FulfillmentUrl = fulfillment_url
+ newOrder.Order = orderDetail
+ reqString, err := json.Marshal(newOrder)
+ if nil != err {
+ return "", err
+ }
+ client := &http.Client{}
+ req, _ := http.NewRequest(http.MethodPost, m.BaseUrlPrivate+"/private/orders", bytes.NewReader(reqString))
+ req.Header.Set("Authorization", "Bearer secret-token:"+m.AccessToken)
+ resp, err := client.Do(req)
+
+ if nil != err {
+ return "", err
+ }
+ defer resp.Body.Close()
+ if http.StatusOK != resp.StatusCode {
+ message := fmt.Sprintf("Expected response code %d. Got %d. With request %s", http.StatusOK, resp.StatusCode, reqString)
+ return "", errors.New(message)
+ }
+ err = json.NewDecoder(resp.Body).Decode(&orderResponse)
+ return orderResponse.OrderId, err
+}
diff --git a/vendor/github.com/schanzen/taler-go/pkg/rest/tos.go b/vendor/github.com/schanzen/taler-go/pkg/rest/tos.go
@@ -0,0 +1,108 @@
+package tos
+
+import (
+ "fmt"
+ "log"
+ "mime"
+ "net/http"
+ "os"
+
+ "golang.org/x/text/language"
+)
+
+type TalerTosConfig struct {
+ // The default file type
+ DefaultFileType string
+
+ // Supported file types
+ SupportedFileTypes []string
+
+ // Default language
+ DefaultLanguage string
+}
+
+func ServiceTermsResponse(w http.ResponseWriter, r *http.Request, termsdatahome string, cfg TalerTosConfig) {
+ fileType := cfg.DefaultFileType
+ termsLocation := termsdatahome
+ for _, typ := range r.Header["Accept"] {
+ for _, a := range cfg.SupportedFileTypes {
+ if typ == a {
+ fileType = a
+ }
+ }
+ }
+
+ if len(r.Header.Get("Accept-Language")) != 0 {
+ acceptLangs, _, _ := language.ParseAcceptLanguage(r.Header.Get("Accept-Language"))
+ for _, lang := range acceptLangs {
+ extensions, _ := mime.ExtensionsByType(fileType)
+ for _, ext := range extensions {
+ docFile := fmt.Sprintf("%s/%s/0%s", termsLocation, lang.String(), ext)
+ log.Printf("Trying %s\n", docFile)
+ fileBytes, err := os.ReadFile(docFile)
+ if nil == err {
+ w.Header().Set("Content-Type", fileType)
+ w.Write(fileBytes)
+ return
+ }
+ }
+ }
+ }
+ // Default document in expected/default format
+ defaultLanguage := cfg.DefaultLanguage
+ extensions, _ := mime.ExtensionsByType(fileType)
+ for _, ext := range extensions {
+ docFile := fmt.Sprintf("%s/%s/0%s", termsLocation, defaultLanguage, ext)
+ log.Println("Trying " + docFile)
+ fileBytes, err := os.ReadFile(docFile)
+ if nil == err {
+ w.Header().Set("Content-Type", fileType)
+ w.Write(fileBytes)
+ return
+ }
+ }
+ w.WriteHeader(http.StatusNotFound)
+}
+
+
+func PrivacyPolicyResponse(w http.ResponseWriter, r *http.Request, policydatahome string, cfg TalerTosConfig) {
+ fileType := cfg.DefaultFileType
+ termsLocation := policydatahome
+ for _, typ := range r.Header["Accept"] {
+ for _, a := range cfg.SupportedFileTypes {
+ if typ == a {
+ fileType = a
+ }
+ }
+ }
+
+ if len(r.Header.Get("Accept-Language")) != 0 {
+ acceptLangs, _, _ := language.ParseAcceptLanguage(r.Header.Get("Accept-Language"))
+ for _, lang := range acceptLangs {
+ extensions, _ := mime.ExtensionsByType(fileType)
+ for _, ext := range extensions {
+ docFile := fmt.Sprintf("%s/%s/0%s", termsLocation, lang.String(), ext)
+ log.Printf("Trying %s\n", docFile)
+ fileBytes, err := os.ReadFile(docFile)
+ if nil == err {
+ w.Header().Set("Content-Type", fileType)
+ w.Write(fileBytes)
+ return
+ }
+ }
+ }
+ }
+ // Default document in expected/default format
+ defaultLanguage := cfg.DefaultLanguage
+ extensions, _ := mime.ExtensionsByType(fileType)
+ for _, ext := range extensions {
+ docFile := fmt.Sprintf("%s/%s/0%s", termsLocation, defaultLanguage, ext)
+ fileBytes, err := os.ReadFile(docFile)
+ if nil == err {
+ w.Header().Set("Content-Type", fileType)
+ w.Write(fileBytes)
+ return
+ }
+ }
+ w.WriteHeader(http.StatusNotFound)
+}
diff --git a/vendor/github.com/schanzen/taler-go/pkg/util/amount.go b/vendor/github.com/schanzen/taler-go/pkg/util/amount.go
@@ -0,0 +1,230 @@
+// This file is part of taler-go, the Taler Go implementation.
+// Copyright (C) 2022 Martin Schanzenbach
+//
+// Taler Go is free software: you can redistribute it and/or modify it
+// under the terms of the GNU Affero General Public License as published
+// by the Free Software Foundation, either version 3 of the License,
+// or (at your option) any later version.
+//
+// Taler Go is distributed in the hope that it will be useful, but
+// WITHOUT ANY WARRANTY; without even the implied warranty of
+// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+// Affero General Public License for more details.
+//
+// You should have received a copy of the GNU Affero General Public License
+// along with this program. If not, see <http://www.gnu.org/licenses/>.
+//
+// SPDX-License-Identifier: AGPL3.0-or-later
+
+package util
+
+import (
+ "errors"
+ "fmt"
+ "math"
+ "regexp"
+ "strconv"
+ "strings"
+)
+
+// The DD51 currency specification for formatting
+type CurrencySpecification struct {
+ // e.g. “Japanese Yen” or "Bitcoin (Mainnet)"
+ Name string `json:"name"`
+
+ // Currency
+ Currency string `json:"currency"`
+
+ // how many digits the user may enter after the decimal separator
+ NumFractionalInputDigits uint `json:"num_fractional_input_digits"`
+
+ // €,$,£: 2; some arabic currencies: 3, ¥: 0
+ NumFractionalNormalDigits uint `json:"num_fractional_normal_digits"`
+
+ // usually same as fractionalNormalDigits, but e.g. might be 2 for ¥
+ NumFractionalTrailingZeroDigits uint `json:"num_fractional_trailing_zero_digits"`
+
+ // map of powers of 10 to alternative currency names / symbols,
+ // must always have an entry under "0" that defines the base name,
+ // e.g. "0 : €" or "3 : k€". For BTC, would be "0 : BTC, -3 : mBTC".
+ // This way, we can also communicate the currency symbol to be used.
+ AltUnitNames map[int]string `json:"alt_unit_names"`
+}
+
+var Currencies = map[string]CurrencySpecification{
+ "KUDOS": {
+ Name: "KUDOS",
+ NumFractionalInputDigits: 2,
+ NumFractionalNormalDigits: 2,
+ AltUnitNames: map[int]string{
+ 0: "KUDOS",
+ },
+ },
+ "USD": {
+ Name: "US Dollar",
+ NumFractionalInputDigits: 2,
+ NumFractionalNormalDigits: 2,
+ AltUnitNames: map[int]string{
+ 0: "$",
+ },
+ },
+ "EUR": {
+ Name: "Euro",
+ NumFractionalInputDigits: 2,
+ NumFractionalNormalDigits: 2,
+ AltUnitNames: map[int]string{
+ 0: "€",
+ },
+ },
+ "JPY": {
+ Name: "Japanese Yen",
+ NumFractionalInputDigits: 2,
+ NumFractionalNormalDigits: 0,
+ AltUnitNames: map[int]string{
+ 0: "¥",
+ },
+ },
+}
+
+// The GNU Taler Amount object
+type Amount struct {
+
+ // The type of currency, e.g. EUR
+ Currency string
+
+ // The value (before the ".")
+ Value uint64
+
+ // The fraction (after the ".", optional)
+ Fraction uint64
+}
+
+// The maximim length of a fraction (in digits)
+const FractionalLength = 8
+
+// The base of the fraction.
+const FractionalBase = 1e8
+
+// The maximum value
+var MaxAmountValue = uint64(math.Pow(2, 52))
+
+// Create a new amount from value and fraction in a currency
+func NewAmount(currency string, value uint64, fraction uint64) Amount {
+ return Amount{
+ Currency: currency,
+ Value: value,
+ Fraction: fraction,
+ }
+}
+
+// FIXME also use altUnitNames.
+func (a *Amount) FormatWithCurrencySpecification(cf CurrencySpecification) (string, error) {
+
+ if cf.NumFractionalNormalDigits == 0 {
+ return fmt.Sprintf("%s %d", cf.AltUnitNames[0], a.Value), nil
+ }
+ return fmt.Sprintf("%s %d.%0*d", cf.AltUnitNames[0], a.Value, cf.NumFractionalNormalDigits, a.Fraction/1e6), nil
+}
+
+func (a *Amount) Format() (string, error) {
+ cf, idx := Currencies[a.Currency]
+ if idx {
+ return a.FormatWithCurrencySpecification(cf)
+ }
+ return "", errors.New("No currency specification found for " + a.Currency)
+}
+
+// Subtract the amount b from a and return the result.
+// a and b must be of the same currency and a >= b
+func (a *Amount) Sub(b Amount) (*Amount, error) {
+ if a.Currency != b.Currency {
+ return nil, errors.New("Currency mismatch!")
+ }
+ v := a.Value
+ f := a.Fraction
+ if a.Fraction < b.Fraction {
+ v -= 1
+ f += FractionalBase
+ }
+ f -= b.Fraction
+ if v < b.Value {
+ return nil, errors.New("Amount Overflow!")
+ }
+ v -= b.Value
+ r := Amount{
+ Currency: a.Currency,
+ Value: v,
+ Fraction: f,
+ }
+ return &r, nil
+}
+
+// Add b to a and return the result.
+// Returns an error if the currencies do not match or the addition would
+// cause an overflow of the value
+func (a *Amount) Add(b Amount) (*Amount, error) {
+ if a.Currency != b.Currency {
+ return nil, errors.New("Currency mismatch!")
+ }
+ v := a.Value +
+ b.Value +
+ uint64(math.Floor((float64(a.Fraction)+float64(b.Fraction))/FractionalBase))
+
+ if v >= MaxAmountValue {
+ return nil, errors.New(fmt.Sprintf("Amount Overflow (%d > %d)!", v, MaxAmountValue))
+ }
+ f := uint64((a.Fraction + b.Fraction) % FractionalBase)
+ r := Amount{
+ Currency: a.Currency,
+ Value: v,
+ Fraction: f,
+ }
+ return &r, nil
+}
+
+// Amounts in GNU Taler must match this regular expression
+var rexAmount = regexp.MustCompile(`^\s*([-_*A-Za-z0-9]+):([0-9]+)\.?([0-9]+)?\s*$`)
+
+// Parses an amount string in the format <currency>:<value>[.<fraction>]
+func ParseAmount(s string) (*Amount, error) {
+ parsed := rexAmount.FindStringSubmatch(s)
+ if nil == parsed {
+ return nil, errors.New(fmt.Sprintf("invalid amount: %s", s))
+ }
+ tail := "0.0"
+ if len(parsed) >= 4 {
+ tail = "0." + parsed[3]
+ }
+ if len(tail) > FractionalLength+1 {
+ return nil, errors.New("fraction too long")
+ }
+ value, err := strconv.ParseUint(parsed[2], 10, 64)
+ if nil != err {
+ return nil, errors.New(fmt.Sprintf("Unable to parse value %s", parsed[2]))
+ }
+ fractionF, err := strconv.ParseFloat(tail, 64)
+ if nil != err {
+ return nil, errors.New(fmt.Sprintf("Unable to parse fraction %s", tail))
+ }
+ fraction := uint64(math.Round(fractionF * FractionalBase))
+ currency := parsed[1]
+ a := NewAmount(currency, value, fraction)
+ return &a, nil
+}
+
+// Check if this amount is zero
+func (a *Amount) IsZero() bool {
+ return (a.Value == 0) && (a.Fraction == 0)
+}
+
+// Returns the string representation of the amount: <currency>:<value>[.<fraction>]
+// Omits trailing zeroes.
+func (a *Amount) String() string {
+ v := strconv.FormatUint(a.Value, 10)
+ if a.Fraction != 0 {
+ f := strconv.FormatUint(a.Fraction, 10)
+ f = strings.TrimRight(f, "0")
+ v = fmt.Sprintf("%s.%s", v, f)
+ }
+ return fmt.Sprintf("%s:%s", a.Currency, v)
+}
diff --git a/vendor/github.com/schanzen/taler-go/pkg/util/configuration.go b/vendor/github.com/schanzen/taler-go/pkg/util/configuration.go
@@ -0,0 +1,123 @@
+// This file is part of taler-go, the Taler Go implementation.
+// Copyright (C) 2022 Martin Schanzenbach
+//
+// Taler Go is free software: you can redistribute it and/or modify it
+// under the terms of the GNU Affero General Public License as published
+// by the Free Software Foundation, either version 3 of the License,
+// or (at your option) any later version.
+//
+// Taler Go is distributed in the hope that it will be useful, but
+// WITHOUT ANY WARRANTY; without even the implied warranty of
+// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+// Affero General Public License for more details.
+//
+// You should have received a copy of the GNU Affero General Public License
+// along with this program. If not, see <http://www.gnu.org/licenses/>.
+//
+// SPDX-License-Identifier: AGPL3.0-or-later
+
+package util
+
+import (
+ "errors"
+ "fmt"
+ "os"
+ "strings"
+ "time"
+
+ "gopkg.in/ini.v1"
+)
+
+type TalerConfiguration struct {
+ // The ini file
+ Ini *ini.File
+}
+
+func (c *TalerConfiguration) GetString(section string, key string, fallback string) string {
+ value := c.Ini.Section(section).Key(strings.ToUpper(key)).String()
+ if len(value) == 0 {
+ return c.Ini.Section(section).Key(strings.ToLower(key)).MustString(fallback)
+ }
+ if len(value) == 0 {
+ return fallback
+ }
+ return value
+}
+
+func (c *TalerConfiguration) GetAmount(section string, key string, fallback *Amount) (*Amount, error) {
+ value := c.GetString(section, key, "")
+ d, err := ParseAmount(value)
+ if err != nil {
+ return fallback, fmt.Errorf("failed to parse %s as amount", value)
+ }
+ return d, nil
+}
+
+func (c *TalerConfiguration) GetDuration(section string, key string, fallback time.Duration) (time.Duration, error) {
+ value := c.GetString(section, key, "")
+ d, err := time.ParseDuration(value)
+ if err != nil {
+ return fallback, fmt.Errorf("failed to parse %s as duration", value)
+ }
+ return d, nil
+}
+
+func (c *TalerConfiguration) GetBool(section string, key string, fallback bool) bool {
+ value, err := c.Ini.Section(section).Key(strings.ToUpper(key)).Bool()
+ if err != nil {
+ return c.Ini.Section(section).Key(strings.ToLower(key)).MustBool(fallback)
+ }
+ return value
+}
+
+func (c *TalerConfiguration) GetInt64(section string, key string, fallback int64) int64 {
+ value, err := c.Ini.Section(section).Key(strings.ToUpper(key)).Int64()
+ if err != nil {
+ return c.Ini.Section(section).Key(strings.ToLower(key)).MustInt64(fallback)
+ }
+ return value
+}
+
+func (c *TalerConfiguration) GetInt(section string, key string, fallback int) int {
+ value, err := c.Ini.Section(section).Key(strings.ToUpper(key)).Int()
+ if err != nil {
+ return c.Ini.Section(section).Key(strings.ToLower(key)).MustInt(fallback)
+ }
+ return value
+}
+
+func getFileName(prefixPath string, relativeFileName string) string {
+ _, err := os.Stat(relativeFileName)
+ if errors.Is(err, os.ErrNotExist) {
+ _, err := os.Stat(prefixPath + "/" + relativeFileName)
+ if errors.Is(err, os.ErrNotExist) {
+ return ""
+ }
+ return prefixPath + "/" + relativeFileName
+ }
+ return relativeFileName
+}
+
+func (c *TalerConfiguration) GetFilename(section string, key string, fallback string, prefixPath string) string {
+ value := c.GetString(section, key, fallback)
+ return getFileName(prefixPath, value)
+}
+
+func (c *TalerConfiguration) IterateSections(sectionPrefix string) []string {
+ result := make([]string, 0)
+ for _, sec := range c.Ini.Sections() {
+ if !strings.HasPrefix(sec.Name(), sectionPrefix) {
+ continue
+ }
+ result = append(result, sec.Name())
+ }
+ return result
+}
+
+func LoadConfiguration(file string) (TalerConfiguration, error) {
+ cfgIni, err := ini.LooseLoad(file)
+ if err != nil {
+ return TalerConfiguration{}, err
+ }
+ return TalerConfiguration{Ini: cfgIni}, nil
+}
diff --git a/vendor/github.com/schanzen/taler-go/pkg/util/db.go b/vendor/github.com/schanzen/taler-go/pkg/util/db.go
@@ -0,0 +1,102 @@
+// This file is part of taler-go, the Taler Go implementation.
+// Copyright (C) 2026 Martin Schanzenbach
+//
+// Taler Go is free software: you can redistribute it and/or modify it
+// under the terms of the GNU Affero General Public License as published
+// by the Free Software Foundation, either version 3 of the License,
+// or (at your option) any later version.
+//
+// Taler Go is distributed in the hope that it will be useful, but
+// WITHOUT ANY WARRANTY; without even the implied warranty of
+// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+// Affero General Public License for more details.
+//
+// You should have received a copy of the GNU Affero General Public License
+// along with this program. If not, see <http://www.gnu.org/licenses/>.
+//
+// SPDX-License-Identifier: AGPL3.0-or-later
+
+package util
+
+import (
+ "database/sql"
+ "fmt"
+ "os"
+ "os/exec"
+ "path/filepath"
+)
+
+func CheckVersioning(db *sql.DB) (bool, error) {
+ rows, err := db.Query(`SELECT schema_name FROM information_schema.schemata WHERE schema_name='_v';`)
+ if err != nil {
+ return false, err
+ }
+ defer rows.Close()
+ if rows.Next() {
+ fmt.Println("Versioning applied")
+ return true, nil
+ }
+ return false, nil
+}
+
+func CheckPatch(db *sql.DB, patchName string) (bool, error) {
+ rows, err := db.Query(`SELECT applied_by FROM _v.patches WHERE patch_name=$1 LIMIT 1;`, patchName)
+ if err != nil {
+ return false, err
+ }
+ defer rows.Close()
+ if rows.Next() {
+ return true, nil
+ }
+ return false, nil
+}
+
+func RunSQL(db *sql.DB, patchName string, dbName string) error {
+ path, err := exec.LookPath("psql")
+ if err != nil {
+ return err
+ }
+ _, err = exec.Command(path, dbName, "-f", patchName, "-q", "--set", "ON_ERROR_STOP=1").Output()
+ fmt.Printf("Running: %s %s %s %s %s %s %s\n", path, dbName, "-f", patchName, "-q", "--set", "ON_ERROR_STOP=1")
+ if err != nil {
+ return err
+ }
+ return nil
+
+}
+
+func DBInit(db *sql.DB, datahome string, dbName string, patchesPrefix string) error {
+ applied, err := CheckVersioning(db)
+ loadSuffix := filepath.Join(datahome, "sql")
+ if err != nil {
+ fmt.Printf("%v\n", err)
+ }
+ if !applied {
+ err := RunSQL(db, filepath.Join(loadSuffix, "versioning.sql"), dbName)
+ if err != nil {
+ return err
+ }
+ }
+ for i := range 10000 {
+ patchName := fmt.Sprintf("%s-%04d", patchesPrefix, i+1)
+ applied, err := CheckPatch(db, patchName)
+ if err != nil {
+ return err
+ }
+ if applied {
+ fmt.Printf("Patch %s already applied\n", patchName)
+ continue
+ }
+ patchFile := fmt.Sprintf("%s.sql", filepath.Join(loadSuffix, patchName))
+ if _, err := os.Stat(patchFile); err != nil {
+ fmt.Printf("Patch %s not found, up-to-date.\n", patchFile)
+ break
+ }
+ fmt.Printf("Applying patch %s\n", patchName)
+ err = RunSQL(db, patchFile, dbName)
+ if err != nil {
+ return err
+ }
+ }
+ return nil
+}
diff --git a/vendor/golang.org/x/text/LICENSE b/vendor/golang.org/x/text/LICENSE
@@ -0,0 +1,27 @@
+Copyright 2009 The Go Authors.
+
+Redistribution and use in source and binary forms, with or without
+modification, are permitted provided that the following conditions are
+met:
+
+ * Redistributions of source code must retain the above copyright
+notice, this list of conditions and the following disclaimer.
+ * Redistributions in binary form must reproduce the above
+copyright notice, this list of conditions and the following disclaimer
+in the documentation and/or other materials provided with the
+distribution.
+ * Neither the name of Google LLC nor the names of its
+contributors may be used to endorse or promote products derived from
+this software without specific prior written permission.
+
+THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS
+"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT
+LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR
+A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT
+OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL,
+SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT
+LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE,
+DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY
+THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT
+(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE
+OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE.
diff --git a/vendor/golang.org/x/text/PATENTS b/vendor/golang.org/x/text/PATENTS
@@ -0,0 +1,22 @@
+Additional IP Rights Grant (Patents)
+
+"This implementation" means the copyrightable works distributed by
+Google as part of the Go project.
+
+Google hereby grants to You a perpetual, worldwide, non-exclusive,
+no-charge, royalty-free, irrevocable (except as stated in this section)
+patent license to make, have made, use, offer to sell, sell, import,
+transfer and otherwise run, modify and propagate the contents of this
+implementation of Go, where such license applies only to those patent
+claims, both currently owned or controlled by Google and acquired in
+the future, licensable by Google that are necessarily infringed by this
+implementation of Go. This grant does not include claims that would be
+infringed only as a consequence of further modification of this
+implementation. If you or your agent or exclusive licensee institute or
+order or agree to the institution of patent litigation against any
+entity (including a cross-claim or counterclaim in a lawsuit) alleging
+that this implementation of Go or any code incorporated within this
+implementation of Go constitutes direct or contributory patent
+infringement, or inducement of patent infringement, then any patent
+rights granted to you under this License for this implementation of Go
+shall terminate as of the date such litigation is filed.
diff --git a/vendor/golang.org/x/text/internal/language/common.go b/vendor/golang.org/x/text/internal/language/common.go
@@ -0,0 +1,16 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package language
+
+// This file contains code common to the maketables.go and the package code.
+
+// AliasType is the type of an alias in AliasMap.
+type AliasType int8
+
+const (
+ Deprecated AliasType = iota
+ Macro
+ Legacy
+
+ AliasTypeUnknown AliasType = -1
+)
diff --git a/vendor/golang.org/x/text/internal/language/compact.go b/vendor/golang.org/x/text/internal/language/compact.go
@@ -0,0 +1,29 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+// CompactCoreInfo is a compact integer with the three core tags encoded.
+type CompactCoreInfo uint32
+
+// GetCompactCore generates a uint32 value that is guaranteed to be unique for
+// different language, region, and script values.
+func GetCompactCore(t Tag) (cci CompactCoreInfo, ok bool) {
+ if t.LangID > langNoIndexOffset {
+ return 0, false
+ }
+ cci |= CompactCoreInfo(t.LangID) << (8 + 12)
+ cci |= CompactCoreInfo(t.ScriptID) << 12
+ cci |= CompactCoreInfo(t.RegionID)
+ return cci, true
+}
+
+// Tag generates a tag from c.
+func (c CompactCoreInfo) Tag() Tag {
+ return Tag{
+ LangID: Language(c >> 20),
+ RegionID: Region(c & 0x3ff),
+ ScriptID: Script(c>>12) & 0xff,
+ }
+}
diff --git a/vendor/golang.org/x/text/internal/language/compact/compact.go b/vendor/golang.org/x/text/internal/language/compact/compact.go
@@ -0,0 +1,61 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package compact defines a compact representation of language tags.
+//
+// Common language tags (at least all for which locale information is defined
+// in CLDR) are assigned a unique index. Each Tag is associated with such an
+// ID for selecting language-related resources (such as translations) as well
+// as one for selecting regional defaults (currency, number formatting, etc.)
+//
+// It may want to export this functionality at some point, but at this point
+// this is only available for use within x/text.
+package compact // import "golang.org/x/text/internal/language/compact"
+
+import (
+ "sort"
+ "strings"
+
+ "golang.org/x/text/internal/language"
+)
+
+// ID is an integer identifying a single tag.
+type ID uint16
+
+func getCoreIndex(t language.Tag) (id ID, ok bool) {
+ cci, ok := language.GetCompactCore(t)
+ if !ok {
+ return 0, false
+ }
+ i := sort.Search(len(coreTags), func(i int) bool {
+ return cci <= coreTags[i]
+ })
+ if i == len(coreTags) || coreTags[i] != cci {
+ return 0, false
+ }
+ return ID(i), true
+}
+
+// Parent returns the ID of the parent or the root ID if id is already the root.
+func (id ID) Parent() ID {
+ return parents[id]
+}
+
+// Tag converts id to an internal language Tag.
+func (id ID) Tag() language.Tag {
+ if int(id) >= len(coreTags) {
+ return specialTags[int(id)-len(coreTags)]
+ }
+ return coreTags[id].Tag()
+}
+
+var specialTags []language.Tag
+
+func init() {
+ tags := strings.Split(specialTagsStr, " ")
+ specialTags = make([]language.Tag, len(tags))
+ for i, t := range tags {
+ specialTags[i] = language.MustParse(t)
+ }
+}
diff --git a/vendor/golang.org/x/text/internal/language/compact/language.go b/vendor/golang.org/x/text/internal/language/compact/language.go
@@ -0,0 +1,260 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:generate go run gen.go gen_index.go -output tables.go
+//go:generate go run gen_parents.go
+
+package compact
+
+// TODO: Remove above NOTE after:
+// - verifying that tables are dropped correctly (most notably matcher tables).
+
+import (
+ "strings"
+
+ "golang.org/x/text/internal/language"
+)
+
+// Tag represents a BCP 47 language tag. It is used to specify an instance of a
+// specific language or locale. All language tag values are guaranteed to be
+// well-formed.
+type Tag struct {
+ // NOTE: exported tags will become part of the public API.
+ language ID
+ locale ID
+ full fullTag // always a language.Tag for now.
+}
+
+const _und = 0
+
+type fullTag interface {
+ IsRoot() bool
+ Parent() language.Tag
+}
+
+// Make a compact Tag from a fully specified internal language Tag.
+func Make(t language.Tag) (tag Tag) {
+ if region := t.TypeForKey("rg"); len(region) == 6 && region[2:] == "zzzz" {
+ if r, err := language.ParseRegion(region[:2]); err == nil {
+ tFull := t
+ t, _ = t.SetTypeForKey("rg", "")
+ // TODO: should we not consider "va" for the language tag?
+ var exact1, exact2 bool
+ tag.language, exact1 = FromTag(t)
+ t.RegionID = r
+ tag.locale, exact2 = FromTag(t)
+ if !exact1 || !exact2 {
+ tag.full = tFull
+ }
+ return tag
+ }
+ }
+ lang, ok := FromTag(t)
+ tag.language = lang
+ tag.locale = lang
+ if !ok {
+ tag.full = t
+ }
+ return tag
+}
+
+// Tag returns an internal language Tag version of this tag.
+func (t Tag) Tag() language.Tag {
+ if t.full != nil {
+ return t.full.(language.Tag)
+ }
+ tag := t.language.Tag()
+ if t.language != t.locale {
+ loc := t.locale.Tag()
+ tag, _ = tag.SetTypeForKey("rg", strings.ToLower(loc.RegionID.String())+"zzzz")
+ }
+ return tag
+}
+
+// IsCompact reports whether this tag is fully defined in terms of ID.
+func (t *Tag) IsCompact() bool {
+ return t.full == nil
+}
+
+// MayHaveVariants reports whether a tag may have variants. If it returns false
+// it is guaranteed the tag does not have variants.
+func (t Tag) MayHaveVariants() bool {
+ return t.full != nil || int(t.language) >= len(coreTags)
+}
+
+// MayHaveExtensions reports whether a tag may have extensions. If it returns
+// false it is guaranteed the tag does not have them.
+func (t Tag) MayHaveExtensions() bool {
+ return t.full != nil ||
+ int(t.language) >= len(coreTags) ||
+ t.language != t.locale
+}
+
+// IsRoot returns true if t is equal to language "und".
+func (t Tag) IsRoot() bool {
+ if t.full != nil {
+ return t.full.IsRoot()
+ }
+ return t.language == _und
+}
+
+// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
+// specific language are substituted with fields from the parent language.
+// The parent for a language may change for newer versions of CLDR.
+func (t Tag) Parent() Tag {
+ if t.full != nil {
+ return Make(t.full.Parent())
+ }
+ if t.language != t.locale {
+ // Simulate stripping -u-rg-xxxxxx
+ return Tag{language: t.language, locale: t.language}
+ }
+ // TODO: use parent lookup table once cycle from internal package is
+ // removed. Probably by internalizing the table and declaring this fast
+ // enough.
+ // lang := compactID(internal.Parent(uint16(t.language)))
+ lang, _ := FromTag(t.language.Tag().Parent())
+ return Tag{language: lang, locale: lang}
+}
+
+// nextToken returns token t and the rest of the string.
+func nextToken(s string) (t, tail string) {
+ p := strings.Index(s[1:], "-")
+ if p == -1 {
+ return s[1:], ""
+ }
+ p++
+ return s[1:p], s[p:]
+}
+
+// LanguageID returns an index, where 0 <= index < NumCompactTags, for tags
+// for which data exists in the text repository.The index will change over time
+// and should not be stored in persistent storage. If t does not match a compact
+// index, exact will be false and the compact index will be returned for the
+// first match after repeatedly taking the Parent of t.
+func LanguageID(t Tag) (id ID, exact bool) {
+ return t.language, t.full == nil
+}
+
+// RegionalID returns the ID for the regional variant of this tag. This index is
+// used to indicate region-specific overrides, such as default currency, default
+// calendar and week data, default time cycle, and default measurement system
+// and unit preferences.
+//
+// For instance, the tag en-GB-u-rg-uszzzz specifies British English with US
+// settings for currency, number formatting, etc. The CompactIndex for this tag
+// will be that for en-GB, while the RegionalID will be the one corresponding to
+// en-US.
+func RegionalID(t Tag) (id ID, exact bool) {
+ return t.locale, t.full == nil
+}
+
+// LanguageTag returns t stripped of regional variant indicators.
+//
+// At the moment this means it is stripped of a regional and variant subtag "rg"
+// and "va" in the "u" extension.
+func (t Tag) LanguageTag() Tag {
+ if t.full == nil {
+ return Tag{language: t.language, locale: t.language}
+ }
+ tt := t.Tag()
+ tt.SetTypeForKey("rg", "")
+ tt.SetTypeForKey("va", "")
+ return Make(tt)
+}
+
+// RegionalTag returns the regional variant of the tag.
+//
+// At the moment this means that the region is set from the regional subtag
+// "rg" in the "u" extension.
+func (t Tag) RegionalTag() Tag {
+ rt := Tag{language: t.locale, locale: t.locale}
+ if t.full == nil {
+ return rt
+ }
+ b := language.Builder{}
+ tag := t.Tag()
+ // tag, _ = tag.SetTypeForKey("rg", "")
+ b.SetTag(t.locale.Tag())
+ if v := tag.Variants(); v != "" {
+ for _, v := range strings.Split(v, "-") {
+ b.AddVariant(v)
+ }
+ }
+ for _, e := range tag.Extensions() {
+ b.AddExt(e)
+ }
+ return t
+}
+
+// FromTag reports closest matching ID for an internal language Tag.
+func FromTag(t language.Tag) (id ID, exact bool) {
+ // TODO: perhaps give more frequent tags a lower index.
+ // TODO: we could make the indexes stable. This will excluded some
+ // possibilities for optimization, so don't do this quite yet.
+ exact = true
+
+ b, s, r := t.Raw()
+ if t.HasString() {
+ if t.IsPrivateUse() {
+ // We have no entries for user-defined tags.
+ return 0, false
+ }
+ hasExtra := false
+ if t.HasVariants() {
+ if t.HasExtensions() {
+ build := language.Builder{}
+ build.SetTag(language.Tag{LangID: b, ScriptID: s, RegionID: r})
+ build.AddVariant(t.Variants())
+ exact = false
+ t = build.Make()
+ }
+ hasExtra = true
+ } else if _, ok := t.Extension('u'); ok {
+ // TODO: va may mean something else. Consider not considering it.
+ // Strip all but the 'va' entry.
+ old := t
+ variant := t.TypeForKey("va")
+ t = language.Tag{LangID: b, ScriptID: s, RegionID: r}
+ if variant != "" {
+ t, _ = t.SetTypeForKey("va", variant)
+ hasExtra = true
+ }
+ exact = old == t
+ } else {
+ exact = false
+ }
+ if hasExtra {
+ // We have some variants.
+ for i, s := range specialTags {
+ if s == t {
+ return ID(i + len(coreTags)), exact
+ }
+ }
+ exact = false
+ }
+ }
+ if x, ok := getCoreIndex(t); ok {
+ return x, exact
+ }
+ exact = false
+ if r != 0 && s == 0 {
+ // Deal with cases where an extra script is inserted for the region.
+ t, _ := t.Maximize()
+ if x, ok := getCoreIndex(t); ok {
+ return x, exact
+ }
+ }
+ for t = t.Parent(); t != root; t = t.Parent() {
+ // No variants specified: just compare core components.
+ // The key has the form lllssrrr, where l, s, and r are nibbles for
+ // respectively the langID, scriptID, and regionID.
+ if x, ok := getCoreIndex(t); ok {
+ return x, exact
+ }
+ }
+ return 0, exact
+}
+
+var root = language.Tag{}
diff --git a/vendor/golang.org/x/text/internal/language/compact/parents.go b/vendor/golang.org/x/text/internal/language/compact/parents.go
@@ -0,0 +1,120 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package compact
+
+// parents maps a compact index of a tag to the compact index of the parent of
+// this tag.
+var parents = []ID{ // 775 elements
+ // Entry 0 - 3F
+ 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0004, 0x0000, 0x0006,
+ 0x0000, 0x0008, 0x0000, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
+ 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
+ 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
+ 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x0000,
+ 0x0000, 0x0028, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x0000,
+ 0x002f, 0x002e, 0x002e, 0x0000, 0x0033, 0x0000, 0x0035, 0x0000,
+ 0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x0000, 0x003e,
+ // Entry 40 - 7F
+ 0x0000, 0x0040, 0x0040, 0x0000, 0x0043, 0x0043, 0x0000, 0x0046,
+ 0x0000, 0x0048, 0x0000, 0x0000, 0x004b, 0x004a, 0x004a, 0x0000,
+ 0x004f, 0x004f, 0x004f, 0x004f, 0x0000, 0x0054, 0x0054, 0x0000,
+ 0x0057, 0x0000, 0x0059, 0x0000, 0x005b, 0x0000, 0x005d, 0x005d,
+ 0x0000, 0x0060, 0x0000, 0x0062, 0x0000, 0x0064, 0x0000, 0x0066,
+ 0x0066, 0x0000, 0x0069, 0x0000, 0x006b, 0x006b, 0x006b, 0x006b,
+ 0x006b, 0x006b, 0x006b, 0x0000, 0x0073, 0x0000, 0x0075, 0x0000,
+ 0x0077, 0x0000, 0x0000, 0x007a, 0x0000, 0x007c, 0x0000, 0x007e,
+ // Entry 80 - BF
+ 0x0000, 0x0080, 0x0080, 0x0000, 0x0083, 0x0083, 0x0000, 0x0086,
+ 0x0087, 0x0087, 0x0087, 0x0086, 0x0088, 0x0087, 0x0087, 0x0087,
+ 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088,
+ 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, 0x0088, 0x0087,
+ 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0086,
+ // Entry C0 - FF
+ 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087,
+ 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0086, 0x0087,
+ 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0000,
+ 0x00ef, 0x0000, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2,
+ 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f1, 0x00f1,
+ // Entry 100 - 13F
+ 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1,
+ 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x0000, 0x010e,
+ 0x0000, 0x0110, 0x0000, 0x0112, 0x0000, 0x0114, 0x0114, 0x0000,
+ 0x0117, 0x0117, 0x0117, 0x0117, 0x0000, 0x011c, 0x0000, 0x011e,
+ 0x0000, 0x0120, 0x0120, 0x0000, 0x0123, 0x0123, 0x0123, 0x0123,
+ 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+ 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+ 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+ // Entry 140 - 17F
+ 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+ 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+ 0x0123, 0x0123, 0x0000, 0x0152, 0x0000, 0x0154, 0x0000, 0x0156,
+ 0x0000, 0x0158, 0x0000, 0x015a, 0x0000, 0x015c, 0x015c, 0x015c,
+ 0x0000, 0x0160, 0x0000, 0x0000, 0x0163, 0x0000, 0x0165, 0x0000,
+ 0x0167, 0x0167, 0x0167, 0x0000, 0x016b, 0x0000, 0x016d, 0x0000,
+ 0x016f, 0x0000, 0x0171, 0x0171, 0x0000, 0x0174, 0x0000, 0x0176,
+ 0x0000, 0x0178, 0x0000, 0x017a, 0x0000, 0x017c, 0x0000, 0x017e,
+ // Entry 180 - 1BF
+ 0x0000, 0x0000, 0x0000, 0x0182, 0x0000, 0x0184, 0x0184, 0x0184,
+ 0x0184, 0x0000, 0x0000, 0x0000, 0x018b, 0x0000, 0x0000, 0x018e,
+ 0x0000, 0x0000, 0x0191, 0x0000, 0x0000, 0x0000, 0x0195, 0x0000,
+ 0x0197, 0x0000, 0x0000, 0x019a, 0x0000, 0x0000, 0x019d, 0x0000,
+ 0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000,
+ 0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x0000, 0x01ad, 0x0000,
+ 0x01af, 0x0000, 0x01b1, 0x01b1, 0x0000, 0x01b4, 0x0000, 0x01b6,
+ 0x0000, 0x01b8, 0x0000, 0x01ba, 0x0000, 0x01bc, 0x0000, 0x0000,
+ // Entry 1C0 - 1FF
+ 0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x0000,
+ 0x01c7, 0x0000, 0x01c9, 0x0000, 0x01cb, 0x01cb, 0x01cb, 0x01cb,
+ 0x0000, 0x01d0, 0x0000, 0x01d2, 0x01d2, 0x0000, 0x01d5, 0x0000,
+ 0x01d7, 0x0000, 0x01d9, 0x0000, 0x01db, 0x0000, 0x01dd, 0x0000,
+ 0x01df, 0x01df, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6,
+ 0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee,
+ 0x0000, 0x01f0, 0x0000, 0x0000, 0x01f3, 0x0000, 0x01f5, 0x01f5,
+ 0x01f5, 0x0000, 0x01f9, 0x0000, 0x01fb, 0x0000, 0x01fd, 0x0000,
+ // Entry 200 - 23F
+ 0x01ff, 0x0000, 0x0000, 0x0202, 0x0000, 0x0204, 0x0204, 0x0000,
+ 0x0207, 0x0000, 0x0209, 0x0209, 0x0000, 0x020c, 0x020c, 0x0000,
+ 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x0000,
+ 0x0217, 0x0000, 0x0219, 0x0000, 0x021b, 0x0000, 0x0000, 0x0000,
+ 0x0000, 0x0000, 0x0221, 0x0000, 0x0000, 0x0224, 0x0000, 0x0226,
+ 0x0226, 0x0000, 0x0229, 0x0000, 0x022b, 0x022b, 0x0000, 0x0000,
+ 0x022f, 0x022e, 0x022e, 0x0000, 0x0000, 0x0234, 0x0000, 0x0236,
+ 0x0000, 0x0238, 0x0000, 0x0244, 0x023a, 0x0244, 0x0244, 0x0244,
+ // Entry 240 - 27F
+ 0x0244, 0x0244, 0x0244, 0x0244, 0x023a, 0x0244, 0x0244, 0x0000,
+ 0x0247, 0x0247, 0x0247, 0x0000, 0x024b, 0x0000, 0x024d, 0x0000,
+ 0x024f, 0x024f, 0x0000, 0x0252, 0x0000, 0x0254, 0x0254, 0x0254,
+ 0x0254, 0x0254, 0x0254, 0x0000, 0x025b, 0x0000, 0x025d, 0x0000,
+ 0x025f, 0x0000, 0x0261, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000,
+ 0x0000, 0x0268, 0x0268, 0x0268, 0x0000, 0x026c, 0x0000, 0x026e,
+ 0x0000, 0x0270, 0x0000, 0x0000, 0x0000, 0x0274, 0x0273, 0x0273,
+ 0x0000, 0x0278, 0x0000, 0x027a, 0x0000, 0x027c, 0x0000, 0x0000,
+ // Entry 280 - 2BF
+ 0x0000, 0x0000, 0x0281, 0x0000, 0x0000, 0x0284, 0x0000, 0x0286,
+ 0x0286, 0x0286, 0x0286, 0x0000, 0x028b, 0x028b, 0x028b, 0x0000,
+ 0x028f, 0x028f, 0x028f, 0x028f, 0x028f, 0x0000, 0x0295, 0x0295,
+ 0x0295, 0x0295, 0x0000, 0x0000, 0x0000, 0x0000, 0x029d, 0x029d,
+ 0x029d, 0x0000, 0x02a1, 0x02a1, 0x02a1, 0x02a1, 0x0000, 0x0000,
+ 0x02a7, 0x02a7, 0x02a7, 0x02a7, 0x0000, 0x02ac, 0x0000, 0x02ae,
+ 0x02ae, 0x0000, 0x02b1, 0x0000, 0x02b3, 0x0000, 0x02b5, 0x02b5,
+ 0x0000, 0x0000, 0x02b9, 0x0000, 0x0000, 0x0000, 0x02bd, 0x0000,
+ // Entry 2C0 - 2FF
+ 0x02bf, 0x02bf, 0x0000, 0x0000, 0x02c3, 0x0000, 0x02c5, 0x0000,
+ 0x02c7, 0x0000, 0x02c9, 0x0000, 0x02cb, 0x0000, 0x02cd, 0x02cd,
+ 0x0000, 0x0000, 0x02d1, 0x0000, 0x02d3, 0x02d0, 0x02d0, 0x0000,
+ 0x0000, 0x02d8, 0x02d7, 0x02d7, 0x0000, 0x0000, 0x02dd, 0x0000,
+ 0x02df, 0x0000, 0x02e1, 0x0000, 0x0000, 0x02e4, 0x0000, 0x02e6,
+ 0x0000, 0x0000, 0x02e9, 0x0000, 0x02eb, 0x0000, 0x02ed, 0x0000,
+ 0x02ef, 0x02ef, 0x0000, 0x0000, 0x02f3, 0x02f2, 0x02f2, 0x0000,
+ 0x02f7, 0x0000, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x0000,
+ // Entry 300 - 33F
+ 0x02ff, 0x0300, 0x02ff, 0x0000, 0x0303, 0x0051, 0x00e6,
+} // Size: 1574 bytes
+
+// Total table size 1574 bytes (1KiB); checksum: 895AAF0B
diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go
@@ -0,0 +1,1015 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package compact
+
+import "golang.org/x/text/internal/language"
+
+// CLDRVersion is the CLDR version from which the tables in this package are derived.
+const CLDRVersion = "32"
+
+// NumCompactTags is the number of common tags. The maximum tag is
+// NumCompactTags-1.
+const NumCompactTags = 775
+const (
+ undIndex ID = 0
+ afIndex ID = 1
+ afNAIndex ID = 2
+ afZAIndex ID = 3
+ agqIndex ID = 4
+ agqCMIndex ID = 5
+ akIndex ID = 6
+ akGHIndex ID = 7
+ amIndex ID = 8
+ amETIndex ID = 9
+ arIndex ID = 10
+ ar001Index ID = 11
+ arAEIndex ID = 12
+ arBHIndex ID = 13
+ arDJIndex ID = 14
+ arDZIndex ID = 15
+ arEGIndex ID = 16
+ arEHIndex ID = 17
+ arERIndex ID = 18
+ arILIndex ID = 19
+ arIQIndex ID = 20
+ arJOIndex ID = 21
+ arKMIndex ID = 22
+ arKWIndex ID = 23
+ arLBIndex ID = 24
+ arLYIndex ID = 25
+ arMAIndex ID = 26
+ arMRIndex ID = 27
+ arOMIndex ID = 28
+ arPSIndex ID = 29
+ arQAIndex ID = 30
+ arSAIndex ID = 31
+ arSDIndex ID = 32
+ arSOIndex ID = 33
+ arSSIndex ID = 34
+ arSYIndex ID = 35
+ arTDIndex ID = 36
+ arTNIndex ID = 37
+ arYEIndex ID = 38
+ arsIndex ID = 39
+ asIndex ID = 40
+ asINIndex ID = 41
+ asaIndex ID = 42
+ asaTZIndex ID = 43
+ astIndex ID = 44
+ astESIndex ID = 45
+ azIndex ID = 46
+ azCyrlIndex ID = 47
+ azCyrlAZIndex ID = 48
+ azLatnIndex ID = 49
+ azLatnAZIndex ID = 50
+ basIndex ID = 51
+ basCMIndex ID = 52
+ beIndex ID = 53
+ beBYIndex ID = 54
+ bemIndex ID = 55
+ bemZMIndex ID = 56
+ bezIndex ID = 57
+ bezTZIndex ID = 58
+ bgIndex ID = 59
+ bgBGIndex ID = 60
+ bhIndex ID = 61
+ bmIndex ID = 62
+ bmMLIndex ID = 63
+ bnIndex ID = 64
+ bnBDIndex ID = 65
+ bnINIndex ID = 66
+ boIndex ID = 67
+ boCNIndex ID = 68
+ boINIndex ID = 69
+ brIndex ID = 70
+ brFRIndex ID = 71
+ brxIndex ID = 72
+ brxINIndex ID = 73
+ bsIndex ID = 74
+ bsCyrlIndex ID = 75
+ bsCyrlBAIndex ID = 76
+ bsLatnIndex ID = 77
+ bsLatnBAIndex ID = 78
+ caIndex ID = 79
+ caADIndex ID = 80
+ caESIndex ID = 81
+ caFRIndex ID = 82
+ caITIndex ID = 83
+ ccpIndex ID = 84
+ ccpBDIndex ID = 85
+ ccpINIndex ID = 86
+ ceIndex ID = 87
+ ceRUIndex ID = 88
+ cggIndex ID = 89
+ cggUGIndex ID = 90
+ chrIndex ID = 91
+ chrUSIndex ID = 92
+ ckbIndex ID = 93
+ ckbIQIndex ID = 94
+ ckbIRIndex ID = 95
+ csIndex ID = 96
+ csCZIndex ID = 97
+ cuIndex ID = 98
+ cuRUIndex ID = 99
+ cyIndex ID = 100
+ cyGBIndex ID = 101
+ daIndex ID = 102
+ daDKIndex ID = 103
+ daGLIndex ID = 104
+ davIndex ID = 105
+ davKEIndex ID = 106
+ deIndex ID = 107
+ deATIndex ID = 108
+ deBEIndex ID = 109
+ deCHIndex ID = 110
+ deDEIndex ID = 111
+ deITIndex ID = 112
+ deLIIndex ID = 113
+ deLUIndex ID = 114
+ djeIndex ID = 115
+ djeNEIndex ID = 116
+ dsbIndex ID = 117
+ dsbDEIndex ID = 118
+ duaIndex ID = 119
+ duaCMIndex ID = 120
+ dvIndex ID = 121
+ dyoIndex ID = 122
+ dyoSNIndex ID = 123
+ dzIndex ID = 124
+ dzBTIndex ID = 125
+ ebuIndex ID = 126
+ ebuKEIndex ID = 127
+ eeIndex ID = 128
+ eeGHIndex ID = 129
+ eeTGIndex ID = 130
+ elIndex ID = 131
+ elCYIndex ID = 132
+ elGRIndex ID = 133
+ enIndex ID = 134
+ en001Index ID = 135
+ en150Index ID = 136
+ enAGIndex ID = 137
+ enAIIndex ID = 138
+ enASIndex ID = 139
+ enATIndex ID = 140
+ enAUIndex ID = 141
+ enBBIndex ID = 142
+ enBEIndex ID = 143
+ enBIIndex ID = 144
+ enBMIndex ID = 145
+ enBSIndex ID = 146
+ enBWIndex ID = 147
+ enBZIndex ID = 148
+ enCAIndex ID = 149
+ enCCIndex ID = 150
+ enCHIndex ID = 151
+ enCKIndex ID = 152
+ enCMIndex ID = 153
+ enCXIndex ID = 154
+ enCYIndex ID = 155
+ enDEIndex ID = 156
+ enDGIndex ID = 157
+ enDKIndex ID = 158
+ enDMIndex ID = 159
+ enERIndex ID = 160
+ enFIIndex ID = 161
+ enFJIndex ID = 162
+ enFKIndex ID = 163
+ enFMIndex ID = 164
+ enGBIndex ID = 165
+ enGDIndex ID = 166
+ enGGIndex ID = 167
+ enGHIndex ID = 168
+ enGIIndex ID = 169
+ enGMIndex ID = 170
+ enGUIndex ID = 171
+ enGYIndex ID = 172
+ enHKIndex ID = 173
+ enIEIndex ID = 174
+ enILIndex ID = 175
+ enIMIndex ID = 176
+ enINIndex ID = 177
+ enIOIndex ID = 178
+ enJEIndex ID = 179
+ enJMIndex ID = 180
+ enKEIndex ID = 181
+ enKIIndex ID = 182
+ enKNIndex ID = 183
+ enKYIndex ID = 184
+ enLCIndex ID = 185
+ enLRIndex ID = 186
+ enLSIndex ID = 187
+ enMGIndex ID = 188
+ enMHIndex ID = 189
+ enMOIndex ID = 190
+ enMPIndex ID = 191
+ enMSIndex ID = 192
+ enMTIndex ID = 193
+ enMUIndex ID = 194
+ enMWIndex ID = 195
+ enMYIndex ID = 196
+ enNAIndex ID = 197
+ enNFIndex ID = 198
+ enNGIndex ID = 199
+ enNLIndex ID = 200
+ enNRIndex ID = 201
+ enNUIndex ID = 202
+ enNZIndex ID = 203
+ enPGIndex ID = 204
+ enPHIndex ID = 205
+ enPKIndex ID = 206
+ enPNIndex ID = 207
+ enPRIndex ID = 208
+ enPWIndex ID = 209
+ enRWIndex ID = 210
+ enSBIndex ID = 211
+ enSCIndex ID = 212
+ enSDIndex ID = 213
+ enSEIndex ID = 214
+ enSGIndex ID = 215
+ enSHIndex ID = 216
+ enSIIndex ID = 217
+ enSLIndex ID = 218
+ enSSIndex ID = 219
+ enSXIndex ID = 220
+ enSZIndex ID = 221
+ enTCIndex ID = 222
+ enTKIndex ID = 223
+ enTOIndex ID = 224
+ enTTIndex ID = 225
+ enTVIndex ID = 226
+ enTZIndex ID = 227
+ enUGIndex ID = 228
+ enUMIndex ID = 229
+ enUSIndex ID = 230
+ enVCIndex ID = 231
+ enVGIndex ID = 232
+ enVIIndex ID = 233
+ enVUIndex ID = 234
+ enWSIndex ID = 235
+ enZAIndex ID = 236
+ enZMIndex ID = 237
+ enZWIndex ID = 238
+ eoIndex ID = 239
+ eo001Index ID = 240
+ esIndex ID = 241
+ es419Index ID = 242
+ esARIndex ID = 243
+ esBOIndex ID = 244
+ esBRIndex ID = 245
+ esBZIndex ID = 246
+ esCLIndex ID = 247
+ esCOIndex ID = 248
+ esCRIndex ID = 249
+ esCUIndex ID = 250
+ esDOIndex ID = 251
+ esEAIndex ID = 252
+ esECIndex ID = 253
+ esESIndex ID = 254
+ esGQIndex ID = 255
+ esGTIndex ID = 256
+ esHNIndex ID = 257
+ esICIndex ID = 258
+ esMXIndex ID = 259
+ esNIIndex ID = 260
+ esPAIndex ID = 261
+ esPEIndex ID = 262
+ esPHIndex ID = 263
+ esPRIndex ID = 264
+ esPYIndex ID = 265
+ esSVIndex ID = 266
+ esUSIndex ID = 267
+ esUYIndex ID = 268
+ esVEIndex ID = 269
+ etIndex ID = 270
+ etEEIndex ID = 271
+ euIndex ID = 272
+ euESIndex ID = 273
+ ewoIndex ID = 274
+ ewoCMIndex ID = 275
+ faIndex ID = 276
+ faAFIndex ID = 277
+ faIRIndex ID = 278
+ ffIndex ID = 279
+ ffCMIndex ID = 280
+ ffGNIndex ID = 281
+ ffMRIndex ID = 282
+ ffSNIndex ID = 283
+ fiIndex ID = 284
+ fiFIIndex ID = 285
+ filIndex ID = 286
+ filPHIndex ID = 287
+ foIndex ID = 288
+ foDKIndex ID = 289
+ foFOIndex ID = 290
+ frIndex ID = 291
+ frBEIndex ID = 292
+ frBFIndex ID = 293
+ frBIIndex ID = 294
+ frBJIndex ID = 295
+ frBLIndex ID = 296
+ frCAIndex ID = 297
+ frCDIndex ID = 298
+ frCFIndex ID = 299
+ frCGIndex ID = 300
+ frCHIndex ID = 301
+ frCIIndex ID = 302
+ frCMIndex ID = 303
+ frDJIndex ID = 304
+ frDZIndex ID = 305
+ frFRIndex ID = 306
+ frGAIndex ID = 307
+ frGFIndex ID = 308
+ frGNIndex ID = 309
+ frGPIndex ID = 310
+ frGQIndex ID = 311
+ frHTIndex ID = 312
+ frKMIndex ID = 313
+ frLUIndex ID = 314
+ frMAIndex ID = 315
+ frMCIndex ID = 316
+ frMFIndex ID = 317
+ frMGIndex ID = 318
+ frMLIndex ID = 319
+ frMQIndex ID = 320
+ frMRIndex ID = 321
+ frMUIndex ID = 322
+ frNCIndex ID = 323
+ frNEIndex ID = 324
+ frPFIndex ID = 325
+ frPMIndex ID = 326
+ frREIndex ID = 327
+ frRWIndex ID = 328
+ frSCIndex ID = 329
+ frSNIndex ID = 330
+ frSYIndex ID = 331
+ frTDIndex ID = 332
+ frTGIndex ID = 333
+ frTNIndex ID = 334
+ frVUIndex ID = 335
+ frWFIndex ID = 336
+ frYTIndex ID = 337
+ furIndex ID = 338
+ furITIndex ID = 339
+ fyIndex ID = 340
+ fyNLIndex ID = 341
+ gaIndex ID = 342
+ gaIEIndex ID = 343
+ gdIndex ID = 344
+ gdGBIndex ID = 345
+ glIndex ID = 346
+ glESIndex ID = 347
+ gswIndex ID = 348
+ gswCHIndex ID = 349
+ gswFRIndex ID = 350
+ gswLIIndex ID = 351
+ guIndex ID = 352
+ guINIndex ID = 353
+ guwIndex ID = 354
+ guzIndex ID = 355
+ guzKEIndex ID = 356
+ gvIndex ID = 357
+ gvIMIndex ID = 358
+ haIndex ID = 359
+ haGHIndex ID = 360
+ haNEIndex ID = 361
+ haNGIndex ID = 362
+ hawIndex ID = 363
+ hawUSIndex ID = 364
+ heIndex ID = 365
+ heILIndex ID = 366
+ hiIndex ID = 367
+ hiINIndex ID = 368
+ hrIndex ID = 369
+ hrBAIndex ID = 370
+ hrHRIndex ID = 371
+ hsbIndex ID = 372
+ hsbDEIndex ID = 373
+ huIndex ID = 374
+ huHUIndex ID = 375
+ hyIndex ID = 376
+ hyAMIndex ID = 377
+ idIndex ID = 378
+ idIDIndex ID = 379
+ igIndex ID = 380
+ igNGIndex ID = 381
+ iiIndex ID = 382
+ iiCNIndex ID = 383
+ inIndex ID = 384
+ ioIndex ID = 385
+ isIndex ID = 386
+ isISIndex ID = 387
+ itIndex ID = 388
+ itCHIndex ID = 389
+ itITIndex ID = 390
+ itSMIndex ID = 391
+ itVAIndex ID = 392
+ iuIndex ID = 393
+ iwIndex ID = 394
+ jaIndex ID = 395
+ jaJPIndex ID = 396
+ jboIndex ID = 397
+ jgoIndex ID = 398
+ jgoCMIndex ID = 399
+ jiIndex ID = 400
+ jmcIndex ID = 401
+ jmcTZIndex ID = 402
+ jvIndex ID = 403
+ jwIndex ID = 404
+ kaIndex ID = 405
+ kaGEIndex ID = 406
+ kabIndex ID = 407
+ kabDZIndex ID = 408
+ kajIndex ID = 409
+ kamIndex ID = 410
+ kamKEIndex ID = 411
+ kcgIndex ID = 412
+ kdeIndex ID = 413
+ kdeTZIndex ID = 414
+ keaIndex ID = 415
+ keaCVIndex ID = 416
+ khqIndex ID = 417
+ khqMLIndex ID = 418
+ kiIndex ID = 419
+ kiKEIndex ID = 420
+ kkIndex ID = 421
+ kkKZIndex ID = 422
+ kkjIndex ID = 423
+ kkjCMIndex ID = 424
+ klIndex ID = 425
+ klGLIndex ID = 426
+ klnIndex ID = 427
+ klnKEIndex ID = 428
+ kmIndex ID = 429
+ kmKHIndex ID = 430
+ knIndex ID = 431
+ knINIndex ID = 432
+ koIndex ID = 433
+ koKPIndex ID = 434
+ koKRIndex ID = 435
+ kokIndex ID = 436
+ kokINIndex ID = 437
+ ksIndex ID = 438
+ ksINIndex ID = 439
+ ksbIndex ID = 440
+ ksbTZIndex ID = 441
+ ksfIndex ID = 442
+ ksfCMIndex ID = 443
+ kshIndex ID = 444
+ kshDEIndex ID = 445
+ kuIndex ID = 446
+ kwIndex ID = 447
+ kwGBIndex ID = 448
+ kyIndex ID = 449
+ kyKGIndex ID = 450
+ lagIndex ID = 451
+ lagTZIndex ID = 452
+ lbIndex ID = 453
+ lbLUIndex ID = 454
+ lgIndex ID = 455
+ lgUGIndex ID = 456
+ lktIndex ID = 457
+ lktUSIndex ID = 458
+ lnIndex ID = 459
+ lnAOIndex ID = 460
+ lnCDIndex ID = 461
+ lnCFIndex ID = 462
+ lnCGIndex ID = 463
+ loIndex ID = 464
+ loLAIndex ID = 465
+ lrcIndex ID = 466
+ lrcIQIndex ID = 467
+ lrcIRIndex ID = 468
+ ltIndex ID = 469
+ ltLTIndex ID = 470
+ luIndex ID = 471
+ luCDIndex ID = 472
+ luoIndex ID = 473
+ luoKEIndex ID = 474
+ luyIndex ID = 475
+ luyKEIndex ID = 476
+ lvIndex ID = 477
+ lvLVIndex ID = 478
+ masIndex ID = 479
+ masKEIndex ID = 480
+ masTZIndex ID = 481
+ merIndex ID = 482
+ merKEIndex ID = 483
+ mfeIndex ID = 484
+ mfeMUIndex ID = 485
+ mgIndex ID = 486
+ mgMGIndex ID = 487
+ mghIndex ID = 488
+ mghMZIndex ID = 489
+ mgoIndex ID = 490
+ mgoCMIndex ID = 491
+ mkIndex ID = 492
+ mkMKIndex ID = 493
+ mlIndex ID = 494
+ mlINIndex ID = 495
+ mnIndex ID = 496
+ mnMNIndex ID = 497
+ moIndex ID = 498
+ mrIndex ID = 499
+ mrINIndex ID = 500
+ msIndex ID = 501
+ msBNIndex ID = 502
+ msMYIndex ID = 503
+ msSGIndex ID = 504
+ mtIndex ID = 505
+ mtMTIndex ID = 506
+ muaIndex ID = 507
+ muaCMIndex ID = 508
+ myIndex ID = 509
+ myMMIndex ID = 510
+ mznIndex ID = 511
+ mznIRIndex ID = 512
+ nahIndex ID = 513
+ naqIndex ID = 514
+ naqNAIndex ID = 515
+ nbIndex ID = 516
+ nbNOIndex ID = 517
+ nbSJIndex ID = 518
+ ndIndex ID = 519
+ ndZWIndex ID = 520
+ ndsIndex ID = 521
+ ndsDEIndex ID = 522
+ ndsNLIndex ID = 523
+ neIndex ID = 524
+ neINIndex ID = 525
+ neNPIndex ID = 526
+ nlIndex ID = 527
+ nlAWIndex ID = 528
+ nlBEIndex ID = 529
+ nlBQIndex ID = 530
+ nlCWIndex ID = 531
+ nlNLIndex ID = 532
+ nlSRIndex ID = 533
+ nlSXIndex ID = 534
+ nmgIndex ID = 535
+ nmgCMIndex ID = 536
+ nnIndex ID = 537
+ nnNOIndex ID = 538
+ nnhIndex ID = 539
+ nnhCMIndex ID = 540
+ noIndex ID = 541
+ nqoIndex ID = 542
+ nrIndex ID = 543
+ nsoIndex ID = 544
+ nusIndex ID = 545
+ nusSSIndex ID = 546
+ nyIndex ID = 547
+ nynIndex ID = 548
+ nynUGIndex ID = 549
+ omIndex ID = 550
+ omETIndex ID = 551
+ omKEIndex ID = 552
+ orIndex ID = 553
+ orINIndex ID = 554
+ osIndex ID = 555
+ osGEIndex ID = 556
+ osRUIndex ID = 557
+ paIndex ID = 558
+ paArabIndex ID = 559
+ paArabPKIndex ID = 560
+ paGuruIndex ID = 561
+ paGuruINIndex ID = 562
+ papIndex ID = 563
+ plIndex ID = 564
+ plPLIndex ID = 565
+ prgIndex ID = 566
+ prg001Index ID = 567
+ psIndex ID = 568
+ psAFIndex ID = 569
+ ptIndex ID = 570
+ ptAOIndex ID = 571
+ ptBRIndex ID = 572
+ ptCHIndex ID = 573
+ ptCVIndex ID = 574
+ ptGQIndex ID = 575
+ ptGWIndex ID = 576
+ ptLUIndex ID = 577
+ ptMOIndex ID = 578
+ ptMZIndex ID = 579
+ ptPTIndex ID = 580
+ ptSTIndex ID = 581
+ ptTLIndex ID = 582
+ quIndex ID = 583
+ quBOIndex ID = 584
+ quECIndex ID = 585
+ quPEIndex ID = 586
+ rmIndex ID = 587
+ rmCHIndex ID = 588
+ rnIndex ID = 589
+ rnBIIndex ID = 590
+ roIndex ID = 591
+ roMDIndex ID = 592
+ roROIndex ID = 593
+ rofIndex ID = 594
+ rofTZIndex ID = 595
+ ruIndex ID = 596
+ ruBYIndex ID = 597
+ ruKGIndex ID = 598
+ ruKZIndex ID = 599
+ ruMDIndex ID = 600
+ ruRUIndex ID = 601
+ ruUAIndex ID = 602
+ rwIndex ID = 603
+ rwRWIndex ID = 604
+ rwkIndex ID = 605
+ rwkTZIndex ID = 606
+ sahIndex ID = 607
+ sahRUIndex ID = 608
+ saqIndex ID = 609
+ saqKEIndex ID = 610
+ sbpIndex ID = 611
+ sbpTZIndex ID = 612
+ sdIndex ID = 613
+ sdPKIndex ID = 614
+ sdhIndex ID = 615
+ seIndex ID = 616
+ seFIIndex ID = 617
+ seNOIndex ID = 618
+ seSEIndex ID = 619
+ sehIndex ID = 620
+ sehMZIndex ID = 621
+ sesIndex ID = 622
+ sesMLIndex ID = 623
+ sgIndex ID = 624
+ sgCFIndex ID = 625
+ shIndex ID = 626
+ shiIndex ID = 627
+ shiLatnIndex ID = 628
+ shiLatnMAIndex ID = 629
+ shiTfngIndex ID = 630
+ shiTfngMAIndex ID = 631
+ siIndex ID = 632
+ siLKIndex ID = 633
+ skIndex ID = 634
+ skSKIndex ID = 635
+ slIndex ID = 636
+ slSIIndex ID = 637
+ smaIndex ID = 638
+ smiIndex ID = 639
+ smjIndex ID = 640
+ smnIndex ID = 641
+ smnFIIndex ID = 642
+ smsIndex ID = 643
+ snIndex ID = 644
+ snZWIndex ID = 645
+ soIndex ID = 646
+ soDJIndex ID = 647
+ soETIndex ID = 648
+ soKEIndex ID = 649
+ soSOIndex ID = 650
+ sqIndex ID = 651
+ sqALIndex ID = 652
+ sqMKIndex ID = 653
+ sqXKIndex ID = 654
+ srIndex ID = 655
+ srCyrlIndex ID = 656
+ srCyrlBAIndex ID = 657
+ srCyrlMEIndex ID = 658
+ srCyrlRSIndex ID = 659
+ srCyrlXKIndex ID = 660
+ srLatnIndex ID = 661
+ srLatnBAIndex ID = 662
+ srLatnMEIndex ID = 663
+ srLatnRSIndex ID = 664
+ srLatnXKIndex ID = 665
+ ssIndex ID = 666
+ ssyIndex ID = 667
+ stIndex ID = 668
+ svIndex ID = 669
+ svAXIndex ID = 670
+ svFIIndex ID = 671
+ svSEIndex ID = 672
+ swIndex ID = 673
+ swCDIndex ID = 674
+ swKEIndex ID = 675
+ swTZIndex ID = 676
+ swUGIndex ID = 677
+ syrIndex ID = 678
+ taIndex ID = 679
+ taINIndex ID = 680
+ taLKIndex ID = 681
+ taMYIndex ID = 682
+ taSGIndex ID = 683
+ teIndex ID = 684
+ teINIndex ID = 685
+ teoIndex ID = 686
+ teoKEIndex ID = 687
+ teoUGIndex ID = 688
+ tgIndex ID = 689
+ tgTJIndex ID = 690
+ thIndex ID = 691
+ thTHIndex ID = 692
+ tiIndex ID = 693
+ tiERIndex ID = 694
+ tiETIndex ID = 695
+ tigIndex ID = 696
+ tkIndex ID = 697
+ tkTMIndex ID = 698
+ tlIndex ID = 699
+ tnIndex ID = 700
+ toIndex ID = 701
+ toTOIndex ID = 702
+ trIndex ID = 703
+ trCYIndex ID = 704
+ trTRIndex ID = 705
+ tsIndex ID = 706
+ ttIndex ID = 707
+ ttRUIndex ID = 708
+ twqIndex ID = 709
+ twqNEIndex ID = 710
+ tzmIndex ID = 711
+ tzmMAIndex ID = 712
+ ugIndex ID = 713
+ ugCNIndex ID = 714
+ ukIndex ID = 715
+ ukUAIndex ID = 716
+ urIndex ID = 717
+ urINIndex ID = 718
+ urPKIndex ID = 719
+ uzIndex ID = 720
+ uzArabIndex ID = 721
+ uzArabAFIndex ID = 722
+ uzCyrlIndex ID = 723
+ uzCyrlUZIndex ID = 724
+ uzLatnIndex ID = 725
+ uzLatnUZIndex ID = 726
+ vaiIndex ID = 727
+ vaiLatnIndex ID = 728
+ vaiLatnLRIndex ID = 729
+ vaiVaiiIndex ID = 730
+ vaiVaiiLRIndex ID = 731
+ veIndex ID = 732
+ viIndex ID = 733
+ viVNIndex ID = 734
+ voIndex ID = 735
+ vo001Index ID = 736
+ vunIndex ID = 737
+ vunTZIndex ID = 738
+ waIndex ID = 739
+ waeIndex ID = 740
+ waeCHIndex ID = 741
+ woIndex ID = 742
+ woSNIndex ID = 743
+ xhIndex ID = 744
+ xogIndex ID = 745
+ xogUGIndex ID = 746
+ yavIndex ID = 747
+ yavCMIndex ID = 748
+ yiIndex ID = 749
+ yi001Index ID = 750
+ yoIndex ID = 751
+ yoBJIndex ID = 752
+ yoNGIndex ID = 753
+ yueIndex ID = 754
+ yueHansIndex ID = 755
+ yueHansCNIndex ID = 756
+ yueHantIndex ID = 757
+ yueHantHKIndex ID = 758
+ zghIndex ID = 759
+ zghMAIndex ID = 760
+ zhIndex ID = 761
+ zhHansIndex ID = 762
+ zhHansCNIndex ID = 763
+ zhHansHKIndex ID = 764
+ zhHansMOIndex ID = 765
+ zhHansSGIndex ID = 766
+ zhHantIndex ID = 767
+ zhHantHKIndex ID = 768
+ zhHantMOIndex ID = 769
+ zhHantTWIndex ID = 770
+ zuIndex ID = 771
+ zuZAIndex ID = 772
+ caESvalenciaIndex ID = 773
+ enUSuvaposixIndex ID = 774
+)
+
+var coreTags = []language.CompactCoreInfo{ // 773 elements
+ // Entry 0 - 1F
+ 0x00000000, 0x01600000, 0x016000d3, 0x01600162,
+ 0x01c00000, 0x01c00052, 0x02100000, 0x02100081,
+ 0x02700000, 0x02700070, 0x03a00000, 0x03a00001,
+ 0x03a00023, 0x03a00039, 0x03a00063, 0x03a00068,
+ 0x03a0006c, 0x03a0006d, 0x03a0006e, 0x03a00098,
+ 0x03a0009c, 0x03a000a2, 0x03a000a9, 0x03a000ad,
+ 0x03a000b1, 0x03a000ba, 0x03a000bb, 0x03a000ca,
+ 0x03a000e2, 0x03a000ee, 0x03a000f4, 0x03a00109,
+ // Entry 20 - 3F
+ 0x03a0010c, 0x03a00116, 0x03a00118, 0x03a0011d,
+ 0x03a00121, 0x03a00129, 0x03a0015f, 0x04000000,
+ 0x04300000, 0x0430009a, 0x04400000, 0x04400130,
+ 0x04800000, 0x0480006f, 0x05800000, 0x05820000,
+ 0x05820032, 0x0585b000, 0x0585b032, 0x05e00000,
+ 0x05e00052, 0x07100000, 0x07100047, 0x07500000,
+ 0x07500163, 0x07900000, 0x07900130, 0x07e00000,
+ 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c4,
+ // Entry 40 - 5F
+ 0x0a500000, 0x0a500035, 0x0a50009a, 0x0a900000,
+ 0x0a900053, 0x0a90009a, 0x0b200000, 0x0b200079,
+ 0x0b500000, 0x0b50009a, 0x0b700000, 0x0b720000,
+ 0x0b720033, 0x0b75b000, 0x0b75b033, 0x0d700000,
+ 0x0d700022, 0x0d70006f, 0x0d700079, 0x0d70009f,
+ 0x0db00000, 0x0db00035, 0x0db0009a, 0x0dc00000,
+ 0x0dc00107, 0x0df00000, 0x0df00132, 0x0e500000,
+ 0x0e500136, 0x0e900000, 0x0e90009c, 0x0e90009d,
+ // Entry 60 - 7F
+ 0x0fa00000, 0x0fa0005f, 0x0fe00000, 0x0fe00107,
+ 0x10000000, 0x1000007c, 0x10100000, 0x10100064,
+ 0x10100083, 0x10800000, 0x108000a5, 0x10d00000,
+ 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00061,
+ 0x10d0009f, 0x10d000b3, 0x10d000b8, 0x11700000,
+ 0x117000d5, 0x11f00000, 0x11f00061, 0x12400000,
+ 0x12400052, 0x12800000, 0x12b00000, 0x12b00115,
+ 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a5,
+ // Entry 80 - 9F
+ 0x13000000, 0x13000081, 0x13000123, 0x13600000,
+ 0x1360005e, 0x13600088, 0x13900000, 0x13900001,
+ 0x1390001a, 0x13900025, 0x13900026, 0x1390002d,
+ 0x1390002e, 0x1390002f, 0x13900034, 0x13900036,
+ 0x1390003a, 0x1390003d, 0x13900042, 0x13900046,
+ 0x13900048, 0x13900049, 0x1390004a, 0x1390004e,
+ 0x13900050, 0x13900052, 0x1390005d, 0x1390005e,
+ 0x13900061, 0x13900062, 0x13900064, 0x13900065,
+ // Entry A0 - BF
+ 0x1390006e, 0x13900073, 0x13900074, 0x13900075,
+ 0x13900076, 0x1390007c, 0x1390007d, 0x13900080,
+ 0x13900081, 0x13900082, 0x13900084, 0x1390008b,
+ 0x1390008d, 0x1390008e, 0x13900097, 0x13900098,
+ 0x13900099, 0x1390009a, 0x1390009b, 0x139000a0,
+ 0x139000a1, 0x139000a5, 0x139000a8, 0x139000aa,
+ 0x139000ae, 0x139000b2, 0x139000b5, 0x139000b6,
+ 0x139000c0, 0x139000c1, 0x139000c7, 0x139000c8,
+ // Entry C0 - DF
+ 0x139000cb, 0x139000cc, 0x139000cd, 0x139000cf,
+ 0x139000d1, 0x139000d3, 0x139000d6, 0x139000d7,
+ 0x139000da, 0x139000de, 0x139000e0, 0x139000e1,
+ 0x139000e7, 0x139000e8, 0x139000e9, 0x139000ec,
+ 0x139000ed, 0x139000f1, 0x13900108, 0x1390010a,
+ 0x1390010b, 0x1390010c, 0x1390010d, 0x1390010e,
+ 0x1390010f, 0x13900110, 0x13900113, 0x13900118,
+ 0x1390011c, 0x1390011e, 0x13900120, 0x13900126,
+ // Entry E0 - FF
+ 0x1390012a, 0x1390012d, 0x1390012e, 0x13900130,
+ 0x13900132, 0x13900134, 0x13900136, 0x1390013a,
+ 0x1390013d, 0x1390013e, 0x13900140, 0x13900143,
+ 0x13900162, 0x13900163, 0x13900165, 0x13c00000,
+ 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c,
+ 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051,
+ 0x13e00054, 0x13e00057, 0x13e0005a, 0x13e00066,
+ 0x13e00069, 0x13e0006a, 0x13e0006f, 0x13e00087,
+ // Entry 100 - 11F
+ 0x13e0008a, 0x13e00090, 0x13e00095, 0x13e000d0,
+ 0x13e000d9, 0x13e000e3, 0x13e000e5, 0x13e000e8,
+ 0x13e000ed, 0x13e000f2, 0x13e0011b, 0x13e00136,
+ 0x13e00137, 0x13e0013c, 0x14000000, 0x1400006b,
+ 0x14500000, 0x1450006f, 0x14600000, 0x14600052,
+ 0x14800000, 0x14800024, 0x1480009d, 0x14e00000,
+ 0x14e00052, 0x14e00085, 0x14e000ca, 0x14e00115,
+ 0x15100000, 0x15100073, 0x15300000, 0x153000e8,
+ // Entry 120 - 13F
+ 0x15800000, 0x15800064, 0x15800077, 0x15e00000,
+ 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b,
+ 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c,
+ 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052,
+ 0x15e00063, 0x15e00068, 0x15e00079, 0x15e0007b,
+ 0x15e0007f, 0x15e00085, 0x15e00086, 0x15e00087,
+ 0x15e00092, 0x15e000a9, 0x15e000b8, 0x15e000bb,
+ 0x15e000bc, 0x15e000bf, 0x15e000c0, 0x15e000c4,
+ // Entry 140 - 15F
+ 0x15e000c9, 0x15e000ca, 0x15e000cd, 0x15e000d4,
+ 0x15e000d5, 0x15e000e6, 0x15e000eb, 0x15e00103,
+ 0x15e00108, 0x15e0010b, 0x15e00115, 0x15e0011d,
+ 0x15e00121, 0x15e00123, 0x15e00129, 0x15e00140,
+ 0x15e00141, 0x15e00160, 0x16900000, 0x1690009f,
+ 0x16d00000, 0x16d000da, 0x16e00000, 0x16e00097,
+ 0x17e00000, 0x17e0007c, 0x19000000, 0x1900006f,
+ 0x1a300000, 0x1a30004e, 0x1a300079, 0x1a3000b3,
+ // Entry 160 - 17F
+ 0x1a400000, 0x1a40009a, 0x1a900000, 0x1ab00000,
+ 0x1ab000a5, 0x1ac00000, 0x1ac00099, 0x1b400000,
+ 0x1b400081, 0x1b4000d5, 0x1b4000d7, 0x1b800000,
+ 0x1b800136, 0x1bc00000, 0x1bc00098, 0x1be00000,
+ 0x1be0009a, 0x1d100000, 0x1d100033, 0x1d100091,
+ 0x1d200000, 0x1d200061, 0x1d500000, 0x1d500093,
+ 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100096,
+ 0x1e700000, 0x1e7000d7, 0x1ea00000, 0x1ea00053,
+ // Entry 180 - 19F
+ 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009e,
+ 0x1f900000, 0x1f90004e, 0x1f90009f, 0x1f900114,
+ 0x1f900139, 0x1fa00000, 0x1fb00000, 0x20000000,
+ 0x200000a3, 0x20300000, 0x20700000, 0x20700052,
+ 0x20800000, 0x20a00000, 0x20a00130, 0x20e00000,
+ 0x20f00000, 0x21000000, 0x2100007e, 0x21200000,
+ 0x21200068, 0x21600000, 0x21700000, 0x217000a5,
+ 0x21f00000, 0x22300000, 0x22300130, 0x22700000,
+ // Entry 1A0 - 1BF
+ 0x2270005b, 0x23400000, 0x234000c4, 0x23900000,
+ 0x239000a5, 0x24200000, 0x242000af, 0x24400000,
+ 0x24400052, 0x24500000, 0x24500083, 0x24600000,
+ 0x246000a5, 0x24a00000, 0x24a000a7, 0x25100000,
+ 0x2510009a, 0x25400000, 0x254000ab, 0x254000ac,
+ 0x25600000, 0x2560009a, 0x26a00000, 0x26a0009a,
+ 0x26b00000, 0x26b00130, 0x26d00000, 0x26d00052,
+ 0x26e00000, 0x26e00061, 0x27400000, 0x28100000,
+ // Entry 1C0 - 1DF
+ 0x2810007c, 0x28a00000, 0x28a000a6, 0x29100000,
+ 0x29100130, 0x29500000, 0x295000b8, 0x2a300000,
+ 0x2a300132, 0x2af00000, 0x2af00136, 0x2b500000,
+ 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d,
+ 0x2b800000, 0x2b8000b0, 0x2bf00000, 0x2bf0009c,
+ 0x2bf0009d, 0x2c000000, 0x2c0000b7, 0x2c200000,
+ 0x2c20004b, 0x2c400000, 0x2c4000a5, 0x2c500000,
+ 0x2c5000a5, 0x2c700000, 0x2c7000b9, 0x2d100000,
+ // Entry 1E0 - 1FF
+ 0x2d1000a5, 0x2d100130, 0x2e900000, 0x2e9000a5,
+ 0x2ed00000, 0x2ed000cd, 0x2f100000, 0x2f1000c0,
+ 0x2f200000, 0x2f2000d2, 0x2f400000, 0x2f400052,
+ 0x2ff00000, 0x2ff000c3, 0x30400000, 0x3040009a,
+ 0x30b00000, 0x30b000c6, 0x31000000, 0x31b00000,
+ 0x31b0009a, 0x31f00000, 0x31f0003e, 0x31f000d1,
+ 0x31f0010e, 0x32000000, 0x320000cc, 0x32500000,
+ 0x32500052, 0x33100000, 0x331000c5, 0x33a00000,
+ // Entry 200 - 21F
+ 0x33a0009d, 0x34100000, 0x34500000, 0x345000d3,
+ 0x34700000, 0x347000db, 0x34700111, 0x34e00000,
+ 0x34e00165, 0x35000000, 0x35000061, 0x350000da,
+ 0x35100000, 0x3510009a, 0x351000dc, 0x36700000,
+ 0x36700030, 0x36700036, 0x36700040, 0x3670005c,
+ 0x367000da, 0x36700117, 0x3670011c, 0x36800000,
+ 0x36800052, 0x36a00000, 0x36a000db, 0x36c00000,
+ 0x36c00052, 0x36f00000, 0x37500000, 0x37600000,
+ // Entry 220 - 23F
+ 0x37a00000, 0x38000000, 0x38000118, 0x38700000,
+ 0x38900000, 0x38900132, 0x39000000, 0x39000070,
+ 0x390000a5, 0x39500000, 0x3950009a, 0x39800000,
+ 0x3980007e, 0x39800107, 0x39d00000, 0x39d05000,
+ 0x39d050e9, 0x39d36000, 0x39d3609a, 0x3a100000,
+ 0x3b300000, 0x3b3000ea, 0x3bd00000, 0x3bd00001,
+ 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a,
+ 0x3c000041, 0x3c00004e, 0x3c00005b, 0x3c000087,
+ // Entry 240 - 25F
+ 0x3c00008c, 0x3c0000b8, 0x3c0000c7, 0x3c0000d2,
+ 0x3c0000ef, 0x3c000119, 0x3c000127, 0x3c400000,
+ 0x3c40003f, 0x3c40006a, 0x3c4000e5, 0x3d400000,
+ 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000,
+ 0x3dc000bd, 0x3dc00105, 0x3de00000, 0x3de00130,
+ 0x3e200000, 0x3e200047, 0x3e2000a6, 0x3e2000af,
+ 0x3e2000bd, 0x3e200107, 0x3e200131, 0x3e500000,
+ 0x3e500108, 0x3e600000, 0x3e600130, 0x3eb00000,
+ // Entry 260 - 27F
+ 0x3eb00107, 0x3ec00000, 0x3ec000a5, 0x3f300000,
+ 0x3f300130, 0x3fa00000, 0x3fa000e9, 0x3fc00000,
+ 0x3fd00000, 0x3fd00073, 0x3fd000db, 0x3fd0010d,
+ 0x3ff00000, 0x3ff000d2, 0x40100000, 0x401000c4,
+ 0x40200000, 0x4020004c, 0x40700000, 0x40800000,
+ 0x4085b000, 0x4085b0bb, 0x408eb000, 0x408eb0bb,
+ 0x40c00000, 0x40c000b4, 0x41200000, 0x41200112,
+ 0x41600000, 0x41600110, 0x41c00000, 0x41d00000,
+ // Entry 280 - 29F
+ 0x41e00000, 0x41f00000, 0x41f00073, 0x42200000,
+ 0x42300000, 0x42300165, 0x42900000, 0x42900063,
+ 0x42900070, 0x429000a5, 0x42900116, 0x43100000,
+ 0x43100027, 0x431000c3, 0x4310014e, 0x43200000,
+ 0x43220000, 0x43220033, 0x432200be, 0x43220106,
+ 0x4322014e, 0x4325b000, 0x4325b033, 0x4325b0be,
+ 0x4325b106, 0x4325b14e, 0x43700000, 0x43a00000,
+ 0x43b00000, 0x44400000, 0x44400031, 0x44400073,
+ // Entry 2A0 - 2BF
+ 0x4440010d, 0x44500000, 0x4450004b, 0x445000a5,
+ 0x44500130, 0x44500132, 0x44e00000, 0x45000000,
+ 0x4500009a, 0x450000b4, 0x450000d1, 0x4500010e,
+ 0x46100000, 0x4610009a, 0x46400000, 0x464000a5,
+ 0x46400132, 0x46700000, 0x46700125, 0x46b00000,
+ 0x46b00124, 0x46f00000, 0x46f0006e, 0x46f00070,
+ 0x47100000, 0x47600000, 0x47600128, 0x47a00000,
+ 0x48000000, 0x48200000, 0x4820012a, 0x48a00000,
+ // Entry 2C0 - 2DF
+ 0x48a0005e, 0x48a0012c, 0x48e00000, 0x49400000,
+ 0x49400107, 0x4a400000, 0x4a4000d5, 0x4a900000,
+ 0x4a9000bb, 0x4ac00000, 0x4ac00053, 0x4ae00000,
+ 0x4ae00131, 0x4b400000, 0x4b40009a, 0x4b4000e9,
+ 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc20000,
+ 0x4bc20138, 0x4bc5b000, 0x4bc5b138, 0x4be00000,
+ 0x4be5b000, 0x4be5b0b5, 0x4bef4000, 0x4bef40b5,
+ 0x4c000000, 0x4c300000, 0x4c30013f, 0x4c900000,
+ // Entry 2E0 - 2FF
+ 0x4c900001, 0x4cc00000, 0x4cc00130, 0x4ce00000,
+ 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500115,
+ 0x4f200000, 0x4fb00000, 0x4fb00132, 0x50900000,
+ 0x50900052, 0x51200000, 0x51200001, 0x51800000,
+ 0x5180003b, 0x518000d7, 0x51f00000, 0x51f3b000,
+ 0x51f3b053, 0x51f3c000, 0x51f3c08e, 0x52800000,
+ 0x528000bb, 0x52900000, 0x5293b000, 0x5293b053,
+ 0x5293b08e, 0x5293b0c7, 0x5293b10e, 0x5293c000,
+ // Entry 300 - 31F
+ 0x5293c08e, 0x5293c0c7, 0x5293c12f, 0x52f00000,
+ 0x52f00162,
+} // Size: 3116 bytes
+
+const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix"
+
+// Total table size 3147 bytes (3KiB); checksum: 5A8FFFA5
diff --git a/vendor/golang.org/x/text/internal/language/compact/tags.go b/vendor/golang.org/x/text/internal/language/compact/tags.go
@@ -0,0 +1,91 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package compact
+
+var (
+ und = Tag{}
+
+ Und Tag = Tag{}
+
+ Afrikaans Tag = Tag{language: afIndex, locale: afIndex}
+ Amharic Tag = Tag{language: amIndex, locale: amIndex}
+ Arabic Tag = Tag{language: arIndex, locale: arIndex}
+ ModernStandardArabic Tag = Tag{language: ar001Index, locale: ar001Index}
+ Azerbaijani Tag = Tag{language: azIndex, locale: azIndex}
+ Bulgarian Tag = Tag{language: bgIndex, locale: bgIndex}
+ Bengali Tag = Tag{language: bnIndex, locale: bnIndex}
+ Catalan Tag = Tag{language: caIndex, locale: caIndex}
+ Czech Tag = Tag{language: csIndex, locale: csIndex}
+ Danish Tag = Tag{language: daIndex, locale: daIndex}
+ German Tag = Tag{language: deIndex, locale: deIndex}
+ Greek Tag = Tag{language: elIndex, locale: elIndex}
+ English Tag = Tag{language: enIndex, locale: enIndex}
+ AmericanEnglish Tag = Tag{language: enUSIndex, locale: enUSIndex}
+ BritishEnglish Tag = Tag{language: enGBIndex, locale: enGBIndex}
+ Spanish Tag = Tag{language: esIndex, locale: esIndex}
+ EuropeanSpanish Tag = Tag{language: esESIndex, locale: esESIndex}
+ LatinAmericanSpanish Tag = Tag{language: es419Index, locale: es419Index}
+ Estonian Tag = Tag{language: etIndex, locale: etIndex}
+ Persian Tag = Tag{language: faIndex, locale: faIndex}
+ Finnish Tag = Tag{language: fiIndex, locale: fiIndex}
+ Filipino Tag = Tag{language: filIndex, locale: filIndex}
+ French Tag = Tag{language: frIndex, locale: frIndex}
+ CanadianFrench Tag = Tag{language: frCAIndex, locale: frCAIndex}
+ Gujarati Tag = Tag{language: guIndex, locale: guIndex}
+ Hebrew Tag = Tag{language: heIndex, locale: heIndex}
+ Hindi Tag = Tag{language: hiIndex, locale: hiIndex}
+ Croatian Tag = Tag{language: hrIndex, locale: hrIndex}
+ Hungarian Tag = Tag{language: huIndex, locale: huIndex}
+ Armenian Tag = Tag{language: hyIndex, locale: hyIndex}
+ Indonesian Tag = Tag{language: idIndex, locale: idIndex}
+ Icelandic Tag = Tag{language: isIndex, locale: isIndex}
+ Italian Tag = Tag{language: itIndex, locale: itIndex}
+ Japanese Tag = Tag{language: jaIndex, locale: jaIndex}
+ Georgian Tag = Tag{language: kaIndex, locale: kaIndex}
+ Kazakh Tag = Tag{language: kkIndex, locale: kkIndex}
+ Khmer Tag = Tag{language: kmIndex, locale: kmIndex}
+ Kannada Tag = Tag{language: knIndex, locale: knIndex}
+ Korean Tag = Tag{language: koIndex, locale: koIndex}
+ Kirghiz Tag = Tag{language: kyIndex, locale: kyIndex}
+ Lao Tag = Tag{language: loIndex, locale: loIndex}
+ Lithuanian Tag = Tag{language: ltIndex, locale: ltIndex}
+ Latvian Tag = Tag{language: lvIndex, locale: lvIndex}
+ Macedonian Tag = Tag{language: mkIndex, locale: mkIndex}
+ Malayalam Tag = Tag{language: mlIndex, locale: mlIndex}
+ Mongolian Tag = Tag{language: mnIndex, locale: mnIndex}
+ Marathi Tag = Tag{language: mrIndex, locale: mrIndex}
+ Malay Tag = Tag{language: msIndex, locale: msIndex}
+ Burmese Tag = Tag{language: myIndex, locale: myIndex}
+ Nepali Tag = Tag{language: neIndex, locale: neIndex}
+ Dutch Tag = Tag{language: nlIndex, locale: nlIndex}
+ Norwegian Tag = Tag{language: noIndex, locale: noIndex}
+ Punjabi Tag = Tag{language: paIndex, locale: paIndex}
+ Polish Tag = Tag{language: plIndex, locale: plIndex}
+ Portuguese Tag = Tag{language: ptIndex, locale: ptIndex}
+ BrazilianPortuguese Tag = Tag{language: ptBRIndex, locale: ptBRIndex}
+ EuropeanPortuguese Tag = Tag{language: ptPTIndex, locale: ptPTIndex}
+ Romanian Tag = Tag{language: roIndex, locale: roIndex}
+ Russian Tag = Tag{language: ruIndex, locale: ruIndex}
+ Sinhala Tag = Tag{language: siIndex, locale: siIndex}
+ Slovak Tag = Tag{language: skIndex, locale: skIndex}
+ Slovenian Tag = Tag{language: slIndex, locale: slIndex}
+ Albanian Tag = Tag{language: sqIndex, locale: sqIndex}
+ Serbian Tag = Tag{language: srIndex, locale: srIndex}
+ SerbianLatin Tag = Tag{language: srLatnIndex, locale: srLatnIndex}
+ Swedish Tag = Tag{language: svIndex, locale: svIndex}
+ Swahili Tag = Tag{language: swIndex, locale: swIndex}
+ Tamil Tag = Tag{language: taIndex, locale: taIndex}
+ Telugu Tag = Tag{language: teIndex, locale: teIndex}
+ Thai Tag = Tag{language: thIndex, locale: thIndex}
+ Turkish Tag = Tag{language: trIndex, locale: trIndex}
+ Ukrainian Tag = Tag{language: ukIndex, locale: ukIndex}
+ Urdu Tag = Tag{language: urIndex, locale: urIndex}
+ Uzbek Tag = Tag{language: uzIndex, locale: uzIndex}
+ Vietnamese Tag = Tag{language: viIndex, locale: viIndex}
+ Chinese Tag = Tag{language: zhIndex, locale: zhIndex}
+ SimplifiedChinese Tag = Tag{language: zhHansIndex, locale: zhHansIndex}
+ TraditionalChinese Tag = Tag{language: zhHantIndex, locale: zhHantIndex}
+ Zulu Tag = Tag{language: zuIndex, locale: zuIndex}
+)
diff --git a/vendor/golang.org/x/text/internal/language/compose.go b/vendor/golang.org/x/text/internal/language/compose.go
@@ -0,0 +1,167 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+ "sort"
+ "strings"
+)
+
+// A Builder allows constructing a Tag from individual components.
+// Its main user is Compose in the top-level language package.
+type Builder struct {
+ Tag Tag
+
+ private string // the x extension
+ variants []string
+ extensions []string
+}
+
+// Make returns a new Tag from the current settings.
+func (b *Builder) Make() Tag {
+ t := b.Tag
+
+ if len(b.extensions) > 0 || len(b.variants) > 0 {
+ sort.Sort(sortVariants(b.variants))
+ sort.Strings(b.extensions)
+
+ if b.private != "" {
+ b.extensions = append(b.extensions, b.private)
+ }
+ n := maxCoreSize + tokenLen(b.variants...) + tokenLen(b.extensions...)
+ buf := make([]byte, n)
+ p := t.genCoreBytes(buf)
+ t.pVariant = byte(p)
+ p += appendTokens(buf[p:], b.variants...)
+ t.pExt = uint16(p)
+ p += appendTokens(buf[p:], b.extensions...)
+ t.str = string(buf[:p])
+ // We may not always need to remake the string, but when or when not
+ // to do so is rather tricky.
+ scan := makeScanner(buf[:p])
+ t, _ = parse(&scan, "")
+ return t
+
+ } else if b.private != "" {
+ t.str = b.private
+ t.RemakeString()
+ }
+ return t
+}
+
+// SetTag copies all the settings from a given Tag. Any previously set values
+// are discarded.
+func (b *Builder) SetTag(t Tag) {
+ b.Tag.LangID = t.LangID
+ b.Tag.RegionID = t.RegionID
+ b.Tag.ScriptID = t.ScriptID
+ // TODO: optimize
+ b.variants = b.variants[:0]
+ if variants := t.Variants(); variants != "" {
+ for _, vr := range strings.Split(variants[1:], "-") {
+ b.variants = append(b.variants, vr)
+ }
+ }
+ b.extensions, b.private = b.extensions[:0], ""
+ for _, e := range t.Extensions() {
+ b.AddExt(e)
+ }
+}
+
+// AddExt adds extension e to the tag. e must be a valid extension as returned
+// by Tag.Extension. If the extension already exists, it will be discarded,
+// except for a -u extension, where non-existing key-type pairs will added.
+func (b *Builder) AddExt(e string) {
+ if e[0] == 'x' {
+ if b.private == "" {
+ b.private = e
+ }
+ return
+ }
+ for i, s := range b.extensions {
+ if s[0] == e[0] {
+ if e[0] == 'u' {
+ b.extensions[i] += e[1:]
+ }
+ return
+ }
+ }
+ b.extensions = append(b.extensions, e)
+}
+
+// SetExt sets the extension e to the tag. e must be a valid extension as
+// returned by Tag.Extension. If the extension already exists, it will be
+// overwritten, except for a -u extension, where the individual key-type pairs
+// will be set.
+func (b *Builder) SetExt(e string) {
+ if e[0] == 'x' {
+ b.private = e
+ return
+ }
+ for i, s := range b.extensions {
+ if s[0] == e[0] {
+ if e[0] == 'u' {
+ b.extensions[i] = e + s[1:]
+ } else {
+ b.extensions[i] = e
+ }
+ return
+ }
+ }
+ b.extensions = append(b.extensions, e)
+}
+
+// AddVariant adds any number of variants.
+func (b *Builder) AddVariant(v ...string) {
+ for _, v := range v {
+ if v != "" {
+ b.variants = append(b.variants, v)
+ }
+ }
+}
+
+// ClearVariants removes any variants previously added, including those
+// copied from a Tag in SetTag.
+func (b *Builder) ClearVariants() {
+ b.variants = b.variants[:0]
+}
+
+// ClearExtensions removes any extensions previously added, including those
+// copied from a Tag in SetTag.
+func (b *Builder) ClearExtensions() {
+ b.private = ""
+ b.extensions = b.extensions[:0]
+}
+
+func tokenLen(token ...string) (n int) {
+ for _, t := range token {
+ n += len(t) + 1
+ }
+ return
+}
+
+func appendTokens(b []byte, token ...string) int {
+ p := 0
+ for _, t := range token {
+ b[p] = '-'
+ copy(b[p+1:], t)
+ p += 1 + len(t)
+ }
+ return p
+}
+
+type sortVariants []string
+
+func (s sortVariants) Len() int {
+ return len(s)
+}
+
+func (s sortVariants) Swap(i, j int) {
+ s[j], s[i] = s[i], s[j]
+}
+
+func (s sortVariants) Less(i, j int) bool {
+ return variantIndex[s[i]] < variantIndex[s[j]]
+}
diff --git a/vendor/golang.org/x/text/internal/language/coverage.go b/vendor/golang.org/x/text/internal/language/coverage.go
@@ -0,0 +1,28 @@
+// Copyright 2014 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+// BaseLanguages returns the list of all supported base languages. It generates
+// the list by traversing the internal structures.
+func BaseLanguages() []Language {
+ base := make([]Language, 0, NumLanguages)
+ for i := 0; i < langNoIndexOffset; i++ {
+ // We included "und" already for the value 0.
+ if i != nonCanonicalUnd {
+ base = append(base, Language(i))
+ }
+ }
+ i := langNoIndexOffset
+ for _, v := range langNoIndex {
+ for k := 0; k < 8; k++ {
+ if v&1 == 1 {
+ base = append(base, Language(i))
+ }
+ v >>= 1
+ i++
+ }
+ }
+ return base
+}
diff --git a/vendor/golang.org/x/text/internal/language/language.go b/vendor/golang.org/x/text/internal/language/language.go
@@ -0,0 +1,627 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:generate go run gen.go gen_common.go -output tables.go
+
+package language // import "golang.org/x/text/internal/language"
+
+// TODO: Remove above NOTE after:
+// - verifying that tables are dropped correctly (most notably matcher tables).
+
+import (
+ "errors"
+ "fmt"
+ "strings"
+)
+
+const (
+ // maxCoreSize is the maximum size of a BCP 47 tag without variants and
+ // extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes.
+ maxCoreSize = 12
+
+ // max99thPercentileSize is a somewhat arbitrary buffer size that presumably
+ // is large enough to hold at least 99% of the BCP 47 tags.
+ max99thPercentileSize = 32
+
+ // maxSimpleUExtensionSize is the maximum size of a -u extension with one
+ // key-type pair. Equals len("-u-") + key (2) + dash + max value (8).
+ maxSimpleUExtensionSize = 14
+)
+
+// Tag represents a BCP 47 language tag. It is used to specify an instance of a
+// specific language or locale. All language tag values are guaranteed to be
+// well-formed. The zero value of Tag is Und.
+type Tag struct {
+ // TODO: the following fields have the form TagTypeID. This name is chosen
+ // to allow refactoring the public package without conflicting with its
+ // Base, Script, and Region methods. Once the transition is fully completed
+ // the ID can be stripped from the name.
+
+ LangID Language
+ RegionID Region
+ // TODO: we will soon run out of positions for ScriptID. Idea: instead of
+ // storing lang, region, and ScriptID codes, store only the compact index and
+ // have a lookup table from this code to its expansion. This greatly speeds
+ // up table lookup, speed up common variant cases.
+ // This will also immediately free up 3 extra bytes. Also, the pVariant
+ // field can now be moved to the lookup table, as the compact index uniquely
+ // determines the offset of a possible variant.
+ ScriptID Script
+ pVariant byte // offset in str, includes preceding '-'
+ pExt uint16 // offset of first extension, includes preceding '-'
+
+ // str is the string representation of the Tag. It will only be used if the
+ // tag has variants or extensions.
+ str string
+}
+
+// Make is a convenience wrapper for Parse that omits the error.
+// In case of an error, a sensible default is returned.
+func Make(s string) Tag {
+ t, _ := Parse(s)
+ return t
+}
+
+// Raw returns the raw base language, script and region, without making an
+// attempt to infer their values.
+// TODO: consider removing
+func (t Tag) Raw() (b Language, s Script, r Region) {
+ return t.LangID, t.ScriptID, t.RegionID
+}
+
+// equalTags compares language, script and region subtags only.
+func (t Tag) equalTags(a Tag) bool {
+ return t.LangID == a.LangID && t.ScriptID == a.ScriptID && t.RegionID == a.RegionID
+}
+
+// IsRoot returns true if t is equal to language "und".
+func (t Tag) IsRoot() bool {
+ if int(t.pVariant) < len(t.str) {
+ return false
+ }
+ return t.equalTags(Und)
+}
+
+// IsPrivateUse reports whether the Tag consists solely of an IsPrivateUse use
+// tag.
+func (t Tag) IsPrivateUse() bool {
+ return t.str != "" && t.pVariant == 0
+}
+
+// RemakeString is used to update t.str in case lang, script or region changed.
+// It is assumed that pExt and pVariant still point to the start of the
+// respective parts.
+func (t *Tag) RemakeString() {
+ if t.str == "" {
+ return
+ }
+ extra := t.str[t.pVariant:]
+ if t.pVariant > 0 {
+ extra = extra[1:]
+ }
+ if t.equalTags(Und) && strings.HasPrefix(extra, "x-") {
+ t.str = extra
+ t.pVariant = 0
+ t.pExt = 0
+ return
+ }
+ var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases.
+ b := buf[:t.genCoreBytes(buf[:])]
+ if extra != "" {
+ diff := len(b) - int(t.pVariant)
+ b = append(b, '-')
+ b = append(b, extra...)
+ t.pVariant = uint8(int(t.pVariant) + diff)
+ t.pExt = uint16(int(t.pExt) + diff)
+ } else {
+ t.pVariant = uint8(len(b))
+ t.pExt = uint16(len(b))
+ }
+ t.str = string(b)
+}
+
+// genCoreBytes writes a string for the base languages, script and region tags
+// to the given buffer and returns the number of bytes written. It will never
+// write more than maxCoreSize bytes.
+func (t *Tag) genCoreBytes(buf []byte) int {
+ n := t.LangID.StringToBuf(buf[:])
+ if t.ScriptID != 0 {
+ n += copy(buf[n:], "-")
+ n += copy(buf[n:], t.ScriptID.String())
+ }
+ if t.RegionID != 0 {
+ n += copy(buf[n:], "-")
+ n += copy(buf[n:], t.RegionID.String())
+ }
+ return n
+}
+
+// String returns the canonical string representation of the language tag.
+func (t Tag) String() string {
+ if t.str != "" {
+ return t.str
+ }
+ if t.ScriptID == 0 && t.RegionID == 0 {
+ return t.LangID.String()
+ }
+ buf := [maxCoreSize]byte{}
+ return string(buf[:t.genCoreBytes(buf[:])])
+}
+
+// MarshalText implements encoding.TextMarshaler.
+func (t Tag) MarshalText() (text []byte, err error) {
+ if t.str != "" {
+ text = append(text, t.str...)
+ } else if t.ScriptID == 0 && t.RegionID == 0 {
+ text = append(text, t.LangID.String()...)
+ } else {
+ buf := [maxCoreSize]byte{}
+ text = buf[:t.genCoreBytes(buf[:])]
+ }
+ return text, nil
+}
+
+// UnmarshalText implements encoding.TextUnmarshaler.
+func (t *Tag) UnmarshalText(text []byte) error {
+ tag, err := Parse(string(text))
+ *t = tag
+ return err
+}
+
+// Variants returns the part of the tag holding all variants or the empty string
+// if there are no variants defined.
+func (t Tag) Variants() string {
+ if t.pVariant == 0 {
+ return ""
+ }
+ return t.str[t.pVariant:t.pExt]
+}
+
+// VariantOrPrivateUseTags returns variants or private use tags.
+func (t Tag) VariantOrPrivateUseTags() string {
+ if t.pExt > 0 {
+ return t.str[t.pVariant:t.pExt]
+ }
+ return t.str[t.pVariant:]
+}
+
+// HasString reports whether this tag defines more than just the raw
+// components.
+func (t Tag) HasString() bool {
+ return t.str != ""
+}
+
+// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
+// specific language are substituted with fields from the parent language.
+// The parent for a language may change for newer versions of CLDR.
+func (t Tag) Parent() Tag {
+ if t.str != "" {
+ // Strip the variants and extensions.
+ b, s, r := t.Raw()
+ t = Tag{LangID: b, ScriptID: s, RegionID: r}
+ if t.RegionID == 0 && t.ScriptID != 0 && t.LangID != 0 {
+ base, _ := addTags(Tag{LangID: t.LangID})
+ if base.ScriptID == t.ScriptID {
+ return Tag{LangID: t.LangID}
+ }
+ }
+ return t
+ }
+ if t.LangID != 0 {
+ if t.RegionID != 0 {
+ maxScript := t.ScriptID
+ if maxScript == 0 {
+ max, _ := addTags(t)
+ maxScript = max.ScriptID
+ }
+
+ for i := range parents {
+ if Language(parents[i].lang) == t.LangID && Script(parents[i].maxScript) == maxScript {
+ for _, r := range parents[i].fromRegion {
+ if Region(r) == t.RegionID {
+ return Tag{
+ LangID: t.LangID,
+ ScriptID: Script(parents[i].script),
+ RegionID: Region(parents[i].toRegion),
+ }
+ }
+ }
+ }
+ }
+
+ // Strip the script if it is the default one.
+ base, _ := addTags(Tag{LangID: t.LangID})
+ if base.ScriptID != maxScript {
+ return Tag{LangID: t.LangID, ScriptID: maxScript}
+ }
+ return Tag{LangID: t.LangID}
+ } else if t.ScriptID != 0 {
+ // The parent for an base-script pair with a non-default script is
+ // "und" instead of the base language.
+ base, _ := addTags(Tag{LangID: t.LangID})
+ if base.ScriptID != t.ScriptID {
+ return Und
+ }
+ return Tag{LangID: t.LangID}
+ }
+ }
+ return Und
+}
+
+// ParseExtension parses s as an extension and returns it on success.
+func ParseExtension(s string) (ext string, err error) {
+ defer func() {
+ if recover() != nil {
+ ext = ""
+ err = ErrSyntax
+ }
+ }()
+
+ scan := makeScannerString(s)
+ var end int
+ if n := len(scan.token); n != 1 {
+ return "", ErrSyntax
+ }
+ scan.toLower(0, len(scan.b))
+ end = parseExtension(&scan)
+ if end != len(s) {
+ return "", ErrSyntax
+ }
+ return string(scan.b), nil
+}
+
+// HasVariants reports whether t has variants.
+func (t Tag) HasVariants() bool {
+ return uint16(t.pVariant) < t.pExt
+}
+
+// HasExtensions reports whether t has extensions.
+func (t Tag) HasExtensions() bool {
+ return int(t.pExt) < len(t.str)
+}
+
+// Extension returns the extension of type x for tag t. It will return
+// false for ok if t does not have the requested extension. The returned
+// extension will be invalid in this case.
+func (t Tag) Extension(x byte) (ext string, ok bool) {
+ for i := int(t.pExt); i < len(t.str)-1; {
+ var ext string
+ i, ext = getExtension(t.str, i)
+ if ext[0] == x {
+ return ext, true
+ }
+ }
+ return "", false
+}
+
+// Extensions returns all extensions of t.
+func (t Tag) Extensions() []string {
+ e := []string{}
+ for i := int(t.pExt); i < len(t.str)-1; {
+ var ext string
+ i, ext = getExtension(t.str, i)
+ e = append(e, ext)
+ }
+ return e
+}
+
+// TypeForKey returns the type associated with the given key, where key and type
+// are of the allowed values defined for the Unicode locale extension ('u') in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// TypeForKey will traverse the inheritance chain to get the correct value.
+//
+// If there are multiple types associated with a key, only the first will be
+// returned. If there is no type associated with a key, it returns the empty
+// string.
+func (t Tag) TypeForKey(key string) string {
+ if _, start, end, _ := t.findTypeForKey(key); end != start {
+ s := t.str[start:end]
+ if p := strings.IndexByte(s, '-'); p >= 0 {
+ s = s[:p]
+ }
+ return s
+ }
+ return ""
+}
+
+var (
+ errPrivateUse = errors.New("cannot set a key on a private use tag")
+ errInvalidArguments = errors.New("invalid key or type")
+)
+
+// SetTypeForKey returns a new Tag with the key set to type, where key and type
+// are of the allowed values defined for the Unicode locale extension ('u') in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// An empty value removes an existing pair with the same key.
+func (t Tag) SetTypeForKey(key, value string) (Tag, error) {
+ if t.IsPrivateUse() {
+ return t, errPrivateUse
+ }
+ if len(key) != 2 {
+ return t, errInvalidArguments
+ }
+
+ // Remove the setting if value is "".
+ if value == "" {
+ start, sep, end, _ := t.findTypeForKey(key)
+ if start != sep {
+ // Remove a possible empty extension.
+ switch {
+ case t.str[start-2] != '-': // has previous elements.
+ case end == len(t.str), // end of string
+ end+2 < len(t.str) && t.str[end+2] == '-': // end of extension
+ start -= 2
+ }
+ if start == int(t.pVariant) && end == len(t.str) {
+ t.str = ""
+ t.pVariant, t.pExt = 0, 0
+ } else {
+ t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:])
+ }
+ }
+ return t, nil
+ }
+
+ if len(value) < 3 || len(value) > 8 {
+ return t, errInvalidArguments
+ }
+
+ var (
+ buf [maxCoreSize + maxSimpleUExtensionSize]byte
+ uStart int // start of the -u extension.
+ )
+
+ // Generate the tag string if needed.
+ if t.str == "" {
+ uStart = t.genCoreBytes(buf[:])
+ buf[uStart] = '-'
+ uStart++
+ }
+
+ // Create new key-type pair and parse it to verify.
+ b := buf[uStart:]
+ copy(b, "u-")
+ copy(b[2:], key)
+ b[4] = '-'
+ b = b[:5+copy(b[5:], value)]
+ scan := makeScanner(b)
+ if parseExtensions(&scan); scan.err != nil {
+ return t, scan.err
+ }
+
+ // Assemble the replacement string.
+ if t.str == "" {
+ t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1)
+ t.str = string(buf[:uStart+len(b)])
+ } else {
+ s := t.str
+ start, sep, end, hasExt := t.findTypeForKey(key)
+ if start == sep {
+ if hasExt {
+ b = b[2:]
+ }
+ t.str = fmt.Sprintf("%s-%s%s", s[:sep], b, s[end:])
+ } else {
+ t.str = fmt.Sprintf("%s-%s%s", s[:start+3], value, s[end:])
+ }
+ }
+ return t, nil
+}
+
+// findTypeForKey returns the start and end position for the type corresponding
+// to key or the point at which to insert the key-value pair if the type
+// wasn't found. The hasExt return value reports whether an -u extension was present.
+// Note: the extensions are typically very small and are likely to contain
+// only one key-type pair.
+func (t Tag) findTypeForKey(key string) (start, sep, end int, hasExt bool) {
+ p := int(t.pExt)
+ if len(key) != 2 || p == len(t.str) || p == 0 {
+ return p, p, p, false
+ }
+ s := t.str
+
+ // Find the correct extension.
+ for p++; s[p] != 'u'; p++ {
+ if s[p] > 'u' {
+ p--
+ return p, p, p, false
+ }
+ if p = nextExtension(s, p); p == len(s) {
+ return len(s), len(s), len(s), false
+ }
+ }
+ // Proceed to the hyphen following the extension name.
+ p++
+
+ // curKey is the key currently being processed.
+ curKey := ""
+
+ // Iterate over keys until we get the end of a section.
+ for {
+ end = p
+ for p++; p < len(s) && s[p] != '-'; p++ {
+ }
+ n := p - end - 1
+ if n <= 2 && curKey == key {
+ if sep < end {
+ sep++
+ }
+ return start, sep, end, true
+ }
+ switch n {
+ case 0, // invalid string
+ 1: // next extension
+ return end, end, end, true
+ case 2:
+ // next key
+ curKey = s[end+1 : p]
+ if curKey > key {
+ return end, end, end, true
+ }
+ start = end
+ sep = p
+ }
+ }
+}
+
+// ParseBase parses a 2- or 3-letter ISO 639 code.
+// It returns a ValueError if s is a well-formed but unknown language identifier
+// or another error if another error occurred.
+func ParseBase(s string) (l Language, err error) {
+ defer func() {
+ if recover() != nil {
+ l = 0
+ err = ErrSyntax
+ }
+ }()
+
+ if n := len(s); n < 2 || 3 < n {
+ return 0, ErrSyntax
+ }
+ var buf [3]byte
+ return getLangID(buf[:copy(buf[:], s)])
+}
+
+// ParseScript parses a 4-letter ISO 15924 code.
+// It returns a ValueError if s is a well-formed but unknown script identifier
+// or another error if another error occurred.
+func ParseScript(s string) (scr Script, err error) {
+ defer func() {
+ if recover() != nil {
+ scr = 0
+ err = ErrSyntax
+ }
+ }()
+
+ if len(s) != 4 {
+ return 0, ErrSyntax
+ }
+ var buf [4]byte
+ return getScriptID(script, buf[:copy(buf[:], s)])
+}
+
+// EncodeM49 returns the Region for the given UN M.49 code.
+// It returns an error if r is not a valid code.
+func EncodeM49(r int) (Region, error) {
+ return getRegionM49(r)
+}
+
+// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code.
+// It returns a ValueError if s is a well-formed but unknown region identifier
+// or another error if another error occurred.
+func ParseRegion(s string) (r Region, err error) {
+ defer func() {
+ if recover() != nil {
+ r = 0
+ err = ErrSyntax
+ }
+ }()
+
+ if n := len(s); n < 2 || 3 < n {
+ return 0, ErrSyntax
+ }
+ var buf [3]byte
+ return getRegionID(buf[:copy(buf[:], s)])
+}
+
+// IsCountry returns whether this region is a country or autonomous area. This
+// includes non-standard definitions from CLDR.
+func (r Region) IsCountry() bool {
+ if r == 0 || r.IsGroup() || r.IsPrivateUse() && r != _XK {
+ return false
+ }
+ return true
+}
+
+// IsGroup returns whether this region defines a collection of regions. This
+// includes non-standard definitions from CLDR.
+func (r Region) IsGroup() bool {
+ if r == 0 {
+ return false
+ }
+ return int(regionInclusion[r]) < len(regionContainment)
+}
+
+// Contains returns whether Region c is contained by Region r. It returns true
+// if c == r.
+func (r Region) Contains(c Region) bool {
+ if r == c {
+ return true
+ }
+ g := regionInclusion[r]
+ if g >= nRegionGroups {
+ return false
+ }
+ m := regionContainment[g]
+
+ d := regionInclusion[c]
+ b := regionInclusionBits[d]
+
+ // A contained country may belong to multiple disjoint groups. Matching any
+ // of these indicates containment. If the contained region is a group, it
+ // must strictly be a subset.
+ if d >= nRegionGroups {
+ return b&m != 0
+ }
+ return b&^m == 0
+}
+
+var errNoTLD = errors.New("language: region is not a valid ccTLD")
+
+// TLD returns the country code top-level domain (ccTLD). UK is returned for GB.
+// In all other cases it returns either the region itself or an error.
+//
+// This method may return an error for a region for which there exists a
+// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The
+// region will already be canonicalized it was obtained from a Tag that was
+// obtained using any of the default methods.
+func (r Region) TLD() (Region, error) {
+ // See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the
+ // difference between ISO 3166-1 and IANA ccTLD.
+ if r == _GB {
+ r = _UK
+ }
+ if (r.typ() & ccTLD) == 0 {
+ return 0, errNoTLD
+ }
+ return r, nil
+}
+
+// Canonicalize returns the region or a possible replacement if the region is
+// deprecated. It will not return a replacement for deprecated regions that
+// are split into multiple regions.
+func (r Region) Canonicalize() Region {
+ if cr := normRegion(r); cr != 0 {
+ return cr
+ }
+ return r
+}
+
+// Variant represents a registered variant of a language as defined by BCP 47.
+type Variant struct {
+ ID uint8
+ str string
+}
+
+// ParseVariant parses and returns a Variant. An error is returned if s is not
+// a valid variant.
+func ParseVariant(s string) (v Variant, err error) {
+ defer func() {
+ if recover() != nil {
+ v = Variant{}
+ err = ErrSyntax
+ }
+ }()
+
+ s = strings.ToLower(s)
+ if id, ok := variantIndex[s]; ok {
+ return Variant{id, s}, nil
+ }
+ return Variant{}, NewValueError([]byte(s))
+}
+
+// String returns the string representation of the variant.
+func (v Variant) String() string {
+ return v.str
+}
diff --git a/vendor/golang.org/x/text/internal/language/lookup.go b/vendor/golang.org/x/text/internal/language/lookup.go
@@ -0,0 +1,412 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+ "bytes"
+ "fmt"
+ "sort"
+ "strconv"
+
+ "golang.org/x/text/internal/tag"
+)
+
+// findIndex tries to find the given tag in idx and returns a standardized error
+// if it could not be found.
+func findIndex(idx tag.Index, key []byte, form string) (index int, err error) {
+ if !tag.FixCase(form, key) {
+ return 0, ErrSyntax
+ }
+ i := idx.Index(key)
+ if i == -1 {
+ return 0, NewValueError(key)
+ }
+ return i, nil
+}
+
+func searchUint(imap []uint16, key uint16) int {
+ return sort.Search(len(imap), func(i int) bool {
+ return imap[i] >= key
+ })
+}
+
+type Language uint16
+
+// getLangID returns the langID of s if s is a canonical subtag
+// or langUnknown if s is not a canonical subtag.
+func getLangID(s []byte) (Language, error) {
+ if len(s) == 2 {
+ return getLangISO2(s)
+ }
+ return getLangISO3(s)
+}
+
+// TODO language normalization as well as the AliasMaps could be moved to the
+// higher level package, but it is a bit tricky to separate the generation.
+
+func (id Language) Canonicalize() (Language, AliasType) {
+ return normLang(id)
+}
+
+// normLang returns the mapped langID of id according to mapping m.
+func normLang(id Language) (Language, AliasType) {
+ k := sort.Search(len(AliasMap), func(i int) bool {
+ return AliasMap[i].From >= uint16(id)
+ })
+ if k < len(AliasMap) && AliasMap[k].From == uint16(id) {
+ return Language(AliasMap[k].To), AliasTypes[k]
+ }
+ return id, AliasTypeUnknown
+}
+
+// getLangISO2 returns the langID for the given 2-letter ISO language code
+// or unknownLang if this does not exist.
+func getLangISO2(s []byte) (Language, error) {
+ if !tag.FixCase("zz", s) {
+ return 0, ErrSyntax
+ }
+ if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 {
+ return Language(i), nil
+ }
+ return 0, NewValueError(s)
+}
+
+const base = 'z' - 'a' + 1
+
+func strToInt(s []byte) uint {
+ v := uint(0)
+ for i := 0; i < len(s); i++ {
+ v *= base
+ v += uint(s[i] - 'a')
+ }
+ return v
+}
+
+// converts the given integer to the original ASCII string passed to strToInt.
+// len(s) must match the number of characters obtained.
+func intToStr(v uint, s []byte) {
+ for i := len(s) - 1; i >= 0; i-- {
+ s[i] = byte(v%base) + 'a'
+ v /= base
+ }
+}
+
+// getLangISO3 returns the langID for the given 3-letter ISO language code
+// or unknownLang if this does not exist.
+func getLangISO3(s []byte) (Language, error) {
+ if tag.FixCase("und", s) {
+ // first try to match canonical 3-letter entries
+ for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) {
+ if e := lang.Elem(i); e[3] == 0 && e[2] == s[2] {
+ // We treat "und" as special and always translate it to "unspecified".
+ // Note that ZZ and Zzzz are private use and are not treated as
+ // unspecified by default.
+ id := Language(i)
+ if id == nonCanonicalUnd {
+ return 0, nil
+ }
+ return id, nil
+ }
+ }
+ if i := altLangISO3.Index(s); i != -1 {
+ return Language(altLangIndex[altLangISO3.Elem(i)[3]]), nil
+ }
+ n := strToInt(s)
+ if langNoIndex[n/8]&(1<<(n%8)) != 0 {
+ return Language(n) + langNoIndexOffset, nil
+ }
+ // Check for non-canonical uses of ISO3.
+ for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) {
+ if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] {
+ return Language(i), nil
+ }
+ }
+ return 0, NewValueError(s)
+ }
+ return 0, ErrSyntax
+}
+
+// StringToBuf writes the string to b and returns the number of bytes
+// written. cap(b) must be >= 3.
+func (id Language) StringToBuf(b []byte) int {
+ if id >= langNoIndexOffset {
+ intToStr(uint(id)-langNoIndexOffset, b[:3])
+ return 3
+ } else if id == 0 {
+ return copy(b, "und")
+ }
+ l := lang[id<<2:]
+ if l[3] == 0 {
+ return copy(b, l[:3])
+ }
+ return copy(b, l[:2])
+}
+
+// String returns the BCP 47 representation of the langID.
+// Use b as variable name, instead of id, to ensure the variable
+// used is consistent with that of Base in which this type is embedded.
+func (b Language) String() string {
+ if b == 0 {
+ return "und"
+ } else if b >= langNoIndexOffset {
+ b -= langNoIndexOffset
+ buf := [3]byte{}
+ intToStr(uint(b), buf[:])
+ return string(buf[:])
+ }
+ l := lang.Elem(int(b))
+ if l[3] == 0 {
+ return l[:3]
+ }
+ return l[:2]
+}
+
+// ISO3 returns the ISO 639-3 language code.
+func (b Language) ISO3() string {
+ if b == 0 || b >= langNoIndexOffset {
+ return b.String()
+ }
+ l := lang.Elem(int(b))
+ if l[3] == 0 {
+ return l[:3]
+ } else if l[2] == 0 {
+ return altLangISO3.Elem(int(l[3]))[:3]
+ }
+ // This allocation will only happen for 3-letter ISO codes
+ // that are non-canonical BCP 47 language identifiers.
+ return l[0:1] + l[2:4]
+}
+
+// IsPrivateUse reports whether this language code is reserved for private use.
+func (b Language) IsPrivateUse() bool {
+ return langPrivateStart <= b && b <= langPrivateEnd
+}
+
+// SuppressScript returns the script marked as SuppressScript in the IANA
+// language tag repository, or 0 if there is no such script.
+func (b Language) SuppressScript() Script {
+ if b < langNoIndexOffset {
+ return Script(suppressScript[b])
+ }
+ return 0
+}
+
+type Region uint16
+
+// getRegionID returns the region id for s if s is a valid 2-letter region code
+// or unknownRegion.
+func getRegionID(s []byte) (Region, error) {
+ if len(s) == 3 {
+ if isAlpha(s[0]) {
+ return getRegionISO3(s)
+ }
+ if i, err := strconv.ParseUint(string(s), 10, 10); err == nil {
+ return getRegionM49(int(i))
+ }
+ }
+ return getRegionISO2(s)
+}
+
+// getRegionISO2 returns the regionID for the given 2-letter ISO country code
+// or unknownRegion if this does not exist.
+func getRegionISO2(s []byte) (Region, error) {
+ i, err := findIndex(regionISO, s, "ZZ")
+ if err != nil {
+ return 0, err
+ }
+ return Region(i) + isoRegionOffset, nil
+}
+
+// getRegionISO3 returns the regionID for the given 3-letter ISO country code
+// or unknownRegion if this does not exist.
+func getRegionISO3(s []byte) (Region, error) {
+ if tag.FixCase("ZZZ", s) {
+ for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) {
+ if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] {
+ return Region(i) + isoRegionOffset, nil
+ }
+ }
+ for i := 0; i < len(altRegionISO3); i += 3 {
+ if tag.Compare(altRegionISO3[i:i+3], s) == 0 {
+ return Region(altRegionIDs[i/3]), nil
+ }
+ }
+ return 0, NewValueError(s)
+ }
+ return 0, ErrSyntax
+}
+
+func getRegionM49(n int) (Region, error) {
+ if 0 < n && n <= 999 {
+ const (
+ searchBits = 7
+ regionBits = 9
+ regionMask = 1<<regionBits - 1
+ )
+ idx := n >> searchBits
+ buf := fromM49[m49Index[idx]:m49Index[idx+1]]
+ val := uint16(n) << regionBits // we rely on bits shifting out
+ i := sort.Search(len(buf), func(i int) bool {
+ return buf[i] >= val
+ })
+ if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val {
+ return Region(r & regionMask), nil
+ }
+ }
+ var e ValueError
+ fmt.Fprint(bytes.NewBuffer([]byte(e.v[:])), n)
+ return 0, e
+}
+
+// normRegion returns a region if r is deprecated or 0 otherwise.
+// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ).
+// TODO: consider mapping split up regions to new most populous one (like CLDR).
+func normRegion(r Region) Region {
+ m := regionOldMap
+ k := sort.Search(len(m), func(i int) bool {
+ return m[i].From >= uint16(r)
+ })
+ if k < len(m) && m[k].From == uint16(r) {
+ return Region(m[k].To)
+ }
+ return 0
+}
+
+const (
+ iso3166UserAssigned = 1 << iota
+ ccTLD
+ bcp47Region
+)
+
+func (r Region) typ() byte {
+ return regionTypes[r]
+}
+
+// String returns the BCP 47 representation for the region.
+// It returns "ZZ" for an unspecified region.
+func (r Region) String() string {
+ if r < isoRegionOffset {
+ if r == 0 {
+ return "ZZ"
+ }
+ return fmt.Sprintf("%03d", r.M49())
+ }
+ r -= isoRegionOffset
+ return regionISO.Elem(int(r))[:2]
+}
+
+// ISO3 returns the 3-letter ISO code of r.
+// Note that not all regions have a 3-letter ISO code.
+// In such cases this method returns "ZZZ".
+func (r Region) ISO3() string {
+ if r < isoRegionOffset {
+ return "ZZZ"
+ }
+ r -= isoRegionOffset
+ reg := regionISO.Elem(int(r))
+ switch reg[2] {
+ case 0:
+ return altRegionISO3[reg[3]:][:3]
+ case ' ':
+ return "ZZZ"
+ }
+ return reg[0:1] + reg[2:4]
+}
+
+// M49 returns the UN M.49 encoding of r, or 0 if this encoding
+// is not defined for r.
+func (r Region) M49() int {
+ return int(m49[r])
+}
+
+// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This
+// may include private-use tags that are assigned by CLDR and used in this
+// implementation. So IsPrivateUse and IsCountry can be simultaneously true.
+func (r Region) IsPrivateUse() bool {
+ return r.typ()&iso3166UserAssigned != 0
+}
+
+type Script uint16
+
+// getScriptID returns the script id for string s. It assumes that s
+// is of the format [A-Z][a-z]{3}.
+func getScriptID(idx tag.Index, s []byte) (Script, error) {
+ i, err := findIndex(idx, s, "Zzzz")
+ return Script(i), err
+}
+
+// String returns the script code in title case.
+// It returns "Zzzz" for an unspecified script.
+func (s Script) String() string {
+ if s == 0 {
+ return "Zzzz"
+ }
+ return script.Elem(int(s))
+}
+
+// IsPrivateUse reports whether this script code is reserved for private use.
+func (s Script) IsPrivateUse() bool {
+ return _Qaaa <= s && s <= _Qabx
+}
+
+const (
+ maxAltTaglen = len("en-US-POSIX")
+ maxLen = maxAltTaglen
+)
+
+var (
+ // grandfatheredMap holds a mapping from legacy and grandfathered tags to
+ // their base language or index to more elaborate tag.
+ grandfatheredMap = map[[maxLen]byte]int16{
+ [maxLen]byte{'a', 'r', 't', '-', 'l', 'o', 'j', 'b', 'a', 'n'}: _jbo, // art-lojban
+ [maxLen]byte{'i', '-', 'a', 'm', 'i'}: _ami, // i-ami
+ [maxLen]byte{'i', '-', 'b', 'n', 'n'}: _bnn, // i-bnn
+ [maxLen]byte{'i', '-', 'h', 'a', 'k'}: _hak, // i-hak
+ [maxLen]byte{'i', '-', 'k', 'l', 'i', 'n', 'g', 'o', 'n'}: _tlh, // i-klingon
+ [maxLen]byte{'i', '-', 'l', 'u', 'x'}: _lb, // i-lux
+ [maxLen]byte{'i', '-', 'n', 'a', 'v', 'a', 'j', 'o'}: _nv, // i-navajo
+ [maxLen]byte{'i', '-', 'p', 'w', 'n'}: _pwn, // i-pwn
+ [maxLen]byte{'i', '-', 't', 'a', 'o'}: _tao, // i-tao
+ [maxLen]byte{'i', '-', 't', 'a', 'y'}: _tay, // i-tay
+ [maxLen]byte{'i', '-', 't', 's', 'u'}: _tsu, // i-tsu
+ [maxLen]byte{'n', 'o', '-', 'b', 'o', 'k'}: _nb, // no-bok
+ [maxLen]byte{'n', 'o', '-', 'n', 'y', 'n'}: _nn, // no-nyn
+ [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'f', 'r'}: _sfb, // sgn-BE-FR
+ [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'n', 'l'}: _vgt, // sgn-BE-NL
+ [maxLen]byte{'s', 'g', 'n', '-', 'c', 'h', '-', 'd', 'e'}: _sgg, // sgn-CH-DE
+ [maxLen]byte{'z', 'h', '-', 'g', 'u', 'o', 'y', 'u'}: _cmn, // zh-guoyu
+ [maxLen]byte{'z', 'h', '-', 'h', 'a', 'k', 'k', 'a'}: _hak, // zh-hakka
+ [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n', '-', 'n', 'a', 'n'}: _nan, // zh-min-nan
+ [maxLen]byte{'z', 'h', '-', 'x', 'i', 'a', 'n', 'g'}: _hsn, // zh-xiang
+
+ // Grandfathered tags with no modern replacement will be converted as
+ // follows:
+ [maxLen]byte{'c', 'e', 'l', '-', 'g', 'a', 'u', 'l', 'i', 's', 'h'}: -1, // cel-gaulish
+ [maxLen]byte{'e', 'n', '-', 'g', 'b', '-', 'o', 'e', 'd'}: -2, // en-GB-oed
+ [maxLen]byte{'i', '-', 'd', 'e', 'f', 'a', 'u', 'l', 't'}: -3, // i-default
+ [maxLen]byte{'i', '-', 'e', 'n', 'o', 'c', 'h', 'i', 'a', 'n'}: -4, // i-enochian
+ [maxLen]byte{'i', '-', 'm', 'i', 'n', 'g', 'o'}: -5, // i-mingo
+ [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n'}: -6, // zh-min
+
+ // CLDR-specific tag.
+ [maxLen]byte{'r', 'o', 'o', 't'}: 0, // root
+ [maxLen]byte{'e', 'n', '-', 'u', 's', '-', 'p', 'o', 's', 'i', 'x'}: -7, // en_US_POSIX"
+ }
+
+ altTagIndex = [...]uint8{0, 17, 31, 45, 61, 74, 86, 102}
+
+ altTags = "xtg-x-cel-gaulishen-GB-oxendicten-x-i-defaultund-x-i-enochiansee-x-i-mingonan-x-zh-minen-US-u-va-posix"
+)
+
+func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) {
+ if v, ok := grandfatheredMap[s]; ok {
+ if v < 0 {
+ return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true
+ }
+ t.LangID = Language(v)
+ return t, true
+ }
+ return t, false
+}
diff --git a/vendor/golang.org/x/text/internal/language/match.go b/vendor/golang.org/x/text/internal/language/match.go
@@ -0,0 +1,226 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import "errors"
+
+type scriptRegionFlags uint8
+
+const (
+ isList = 1 << iota
+ scriptInFrom
+ regionInFrom
+)
+
+func (t *Tag) setUndefinedLang(id Language) {
+ if t.LangID == 0 {
+ t.LangID = id
+ }
+}
+
+func (t *Tag) setUndefinedScript(id Script) {
+ if t.ScriptID == 0 {
+ t.ScriptID = id
+ }
+}
+
+func (t *Tag) setUndefinedRegion(id Region) {
+ if t.RegionID == 0 || t.RegionID.Contains(id) {
+ t.RegionID = id
+ }
+}
+
+// ErrMissingLikelyTagsData indicates no information was available
+// to compute likely values of missing tags.
+var ErrMissingLikelyTagsData = errors.New("missing likely tags data")
+
+// addLikelySubtags sets subtags to their most likely value, given the locale.
+// In most cases this means setting fields for unknown values, but in some
+// cases it may alter a value. It returns an ErrMissingLikelyTagsData error
+// if the given locale cannot be expanded.
+func (t Tag) addLikelySubtags() (Tag, error) {
+ id, err := addTags(t)
+ if err != nil {
+ return t, err
+ } else if id.equalTags(t) {
+ return t, nil
+ }
+ id.RemakeString()
+ return id, nil
+}
+
+// specializeRegion attempts to specialize a group region.
+func specializeRegion(t *Tag) bool {
+ if i := regionInclusion[t.RegionID]; i < nRegionGroups {
+ x := likelyRegionGroup[i]
+ if Language(x.lang) == t.LangID && Script(x.script) == t.ScriptID {
+ t.RegionID = Region(x.region)
+ }
+ return true
+ }
+ return false
+}
+
+// Maximize returns a new tag with missing tags filled in.
+func (t Tag) Maximize() (Tag, error) {
+ return addTags(t)
+}
+
+func addTags(t Tag) (Tag, error) {
+ // We leave private use identifiers alone.
+ if t.IsPrivateUse() {
+ return t, nil
+ }
+ if t.ScriptID != 0 && t.RegionID != 0 {
+ if t.LangID != 0 {
+ // already fully specified
+ specializeRegion(&t)
+ return t, nil
+ }
+ // Search matches for und-script-region. Note that for these cases
+ // region will never be a group so there is no need to check for this.
+ list := likelyRegion[t.RegionID : t.RegionID+1]
+ if x := list[0]; x.flags&isList != 0 {
+ list = likelyRegionList[x.lang : x.lang+uint16(x.script)]
+ }
+ for _, x := range list {
+ // Deviating from the spec. See match_test.go for details.
+ if Script(x.script) == t.ScriptID {
+ t.setUndefinedLang(Language(x.lang))
+ return t, nil
+ }
+ }
+ }
+ if t.LangID != 0 {
+ // Search matches for lang-script and lang-region, where lang != und.
+ if t.LangID < langNoIndexOffset {
+ x := likelyLang[t.LangID]
+ if x.flags&isList != 0 {
+ list := likelyLangList[x.region : x.region+uint16(x.script)]
+ if t.ScriptID != 0 {
+ for _, x := range list {
+ if Script(x.script) == t.ScriptID && x.flags&scriptInFrom != 0 {
+ t.setUndefinedRegion(Region(x.region))
+ return t, nil
+ }
+ }
+ } else if t.RegionID != 0 {
+ count := 0
+ goodScript := true
+ tt := t
+ for _, x := range list {
+ // We visit all entries for which the script was not
+ // defined, including the ones where the region was not
+ // defined. This allows for proper disambiguation within
+ // regions.
+ if x.flags&scriptInFrom == 0 && t.RegionID.Contains(Region(x.region)) {
+ tt.RegionID = Region(x.region)
+ tt.setUndefinedScript(Script(x.script))
+ goodScript = goodScript && tt.ScriptID == Script(x.script)
+ count++
+ }
+ }
+ if count == 1 {
+ return tt, nil
+ }
+ // Even if we fail to find a unique Region, we might have
+ // an unambiguous script.
+ if goodScript {
+ t.ScriptID = tt.ScriptID
+ }
+ }
+ }
+ }
+ } else {
+ // Search matches for und-script.
+ if t.ScriptID != 0 {
+ x := likelyScript[t.ScriptID]
+ if x.region != 0 {
+ t.setUndefinedRegion(Region(x.region))
+ t.setUndefinedLang(Language(x.lang))
+ return t, nil
+ }
+ }
+ // Search matches for und-region. If und-script-region exists, it would
+ // have been found earlier.
+ if t.RegionID != 0 {
+ if i := regionInclusion[t.RegionID]; i < nRegionGroups {
+ x := likelyRegionGroup[i]
+ if x.region != 0 {
+ t.setUndefinedLang(Language(x.lang))
+ t.setUndefinedScript(Script(x.script))
+ t.RegionID = Region(x.region)
+ }
+ } else {
+ x := likelyRegion[t.RegionID]
+ if x.flags&isList != 0 {
+ x = likelyRegionList[x.lang]
+ }
+ if x.script != 0 && x.flags != scriptInFrom {
+ t.setUndefinedLang(Language(x.lang))
+ t.setUndefinedScript(Script(x.script))
+ return t, nil
+ }
+ }
+ }
+ }
+
+ // Search matches for lang.
+ if t.LangID < langNoIndexOffset {
+ x := likelyLang[t.LangID]
+ if x.flags&isList != 0 {
+ x = likelyLangList[x.region]
+ }
+ if x.region != 0 {
+ t.setUndefinedScript(Script(x.script))
+ t.setUndefinedRegion(Region(x.region))
+ }
+ specializeRegion(&t)
+ if t.LangID == 0 {
+ t.LangID = _en // default language
+ }
+ return t, nil
+ }
+ return t, ErrMissingLikelyTagsData
+}
+
+func (t *Tag) setTagsFrom(id Tag) {
+ t.LangID = id.LangID
+ t.ScriptID = id.ScriptID
+ t.RegionID = id.RegionID
+}
+
+// minimize removes the region or script subtags from t such that
+// t.addLikelySubtags() == t.minimize().addLikelySubtags().
+func (t Tag) minimize() (Tag, error) {
+ t, err := minimizeTags(t)
+ if err != nil {
+ return t, err
+ }
+ t.RemakeString()
+ return t, nil
+}
+
+// minimizeTags mimics the behavior of the ICU 51 C implementation.
+func minimizeTags(t Tag) (Tag, error) {
+ if t.equalTags(Und) {
+ return t, nil
+ }
+ max, err := addTags(t)
+ if err != nil {
+ return t, err
+ }
+ for _, id := range [...]Tag{
+ {LangID: t.LangID},
+ {LangID: t.LangID, RegionID: t.RegionID},
+ {LangID: t.LangID, ScriptID: t.ScriptID},
+ } {
+ if x, err := addTags(id); err == nil && max.equalTags(x) {
+ t.setTagsFrom(id)
+ break
+ }
+ }
+ return t, nil
+}
diff --git a/vendor/golang.org/x/text/internal/language/parse.go b/vendor/golang.org/x/text/internal/language/parse.go
@@ -0,0 +1,608 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+ "bytes"
+ "errors"
+ "fmt"
+ "sort"
+
+ "golang.org/x/text/internal/tag"
+)
+
+// isAlpha returns true if the byte is not a digit.
+// b must be an ASCII letter or digit.
+func isAlpha(b byte) bool {
+ return b > '9'
+}
+
+// isAlphaNum returns true if the string contains only ASCII letters or digits.
+func isAlphaNum(s []byte) bool {
+ for _, c := range s {
+ if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') {
+ return false
+ }
+ }
+ return true
+}
+
+// ErrSyntax is returned by any of the parsing functions when the
+// input is not well-formed, according to BCP 47.
+// TODO: return the position at which the syntax error occurred?
+var ErrSyntax = errors.New("language: tag is not well-formed")
+
+// ErrDuplicateKey is returned when a tag contains the same key twice with
+// different values in the -u section.
+var ErrDuplicateKey = errors.New("language: different values for same key in -u extension")
+
+// ValueError is returned by any of the parsing functions when the
+// input is well-formed but the respective subtag is not recognized
+// as a valid value.
+type ValueError struct {
+ v [8]byte
+}
+
+// NewValueError creates a new ValueError.
+func NewValueError(tag []byte) ValueError {
+ var e ValueError
+ copy(e.v[:], tag)
+ return e
+}
+
+func (e ValueError) tag() []byte {
+ n := bytes.IndexByte(e.v[:], 0)
+ if n == -1 {
+ n = 8
+ }
+ return e.v[:n]
+}
+
+// Error implements the error interface.
+func (e ValueError) Error() string {
+ return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag())
+}
+
+// Subtag returns the subtag for which the error occurred.
+func (e ValueError) Subtag() string {
+ return string(e.tag())
+}
+
+// scanner is used to scan BCP 47 tokens, which are separated by _ or -.
+type scanner struct {
+ b []byte
+ bytes [max99thPercentileSize]byte
+ token []byte
+ start int // start position of the current token
+ end int // end position of the current token
+ next int // next point for scan
+ err error
+ done bool
+}
+
+func makeScannerString(s string) scanner {
+ scan := scanner{}
+ if len(s) <= len(scan.bytes) {
+ scan.b = scan.bytes[:copy(scan.bytes[:], s)]
+ } else {
+ scan.b = []byte(s)
+ }
+ scan.init()
+ return scan
+}
+
+// makeScanner returns a scanner using b as the input buffer.
+// b is not copied and may be modified by the scanner routines.
+func makeScanner(b []byte) scanner {
+ scan := scanner{b: b}
+ scan.init()
+ return scan
+}
+
+func (s *scanner) init() {
+ for i, c := range s.b {
+ if c == '_' {
+ s.b[i] = '-'
+ }
+ }
+ s.scan()
+}
+
+// restToLower converts the string between start and end to lower case.
+func (s *scanner) toLower(start, end int) {
+ for i := start; i < end; i++ {
+ c := s.b[i]
+ if 'A' <= c && c <= 'Z' {
+ s.b[i] += 'a' - 'A'
+ }
+ }
+}
+
+func (s *scanner) setError(e error) {
+ if s.err == nil || (e == ErrSyntax && s.err != ErrSyntax) {
+ s.err = e
+ }
+}
+
+// resizeRange shrinks or grows the array at position oldStart such that
+// a new string of size newSize can fit between oldStart and oldEnd.
+// Sets the scan point to after the resized range.
+func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) {
+ s.start = oldStart
+ if end := oldStart + newSize; end != oldEnd {
+ diff := end - oldEnd
+ var b []byte
+ if n := len(s.b) + diff; n > cap(s.b) {
+ b = make([]byte, n)
+ copy(b, s.b[:oldStart])
+ } else {
+ b = s.b[:n]
+ }
+ copy(b[end:], s.b[oldEnd:])
+ s.b = b
+ s.next = end + (s.next - s.end)
+ s.end = end
+ }
+}
+
+// replace replaces the current token with repl.
+func (s *scanner) replace(repl string) {
+ s.resizeRange(s.start, s.end, len(repl))
+ copy(s.b[s.start:], repl)
+}
+
+// gobble removes the current token from the input.
+// Caller must call scan after calling gobble.
+func (s *scanner) gobble(e error) {
+ s.setError(e)
+ if s.start == 0 {
+ s.b = s.b[:+copy(s.b, s.b[s.next:])]
+ s.end = 0
+ } else {
+ s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])]
+ s.end = s.start - 1
+ }
+ s.next = s.start
+}
+
+// deleteRange removes the given range from s.b before the current token.
+func (s *scanner) deleteRange(start, end int) {
+ s.b = s.b[:start+copy(s.b[start:], s.b[end:])]
+ diff := end - start
+ s.next -= diff
+ s.start -= diff
+ s.end -= diff
+}
+
+// scan parses the next token of a BCP 47 string. Tokens that are larger
+// than 8 characters or include non-alphanumeric characters result in an error
+// and are gobbled and removed from the output.
+// It returns the end position of the last token consumed.
+func (s *scanner) scan() (end int) {
+ end = s.end
+ s.token = nil
+ for s.start = s.next; s.next < len(s.b); {
+ i := bytes.IndexByte(s.b[s.next:], '-')
+ if i == -1 {
+ s.end = len(s.b)
+ s.next = len(s.b)
+ i = s.end - s.start
+ } else {
+ s.end = s.next + i
+ s.next = s.end + 1
+ }
+ token := s.b[s.start:s.end]
+ if i < 1 || i > 8 || !isAlphaNum(token) {
+ s.gobble(ErrSyntax)
+ continue
+ }
+ s.token = token
+ return end
+ }
+ if n := len(s.b); n > 0 && s.b[n-1] == '-' {
+ s.setError(ErrSyntax)
+ s.b = s.b[:len(s.b)-1]
+ }
+ s.done = true
+ return end
+}
+
+// acceptMinSize parses multiple tokens of the given size or greater.
+// It returns the end position of the last token consumed.
+func (s *scanner) acceptMinSize(min int) (end int) {
+ end = s.end
+ s.scan()
+ for ; len(s.token) >= min; s.scan() {
+ end = s.end
+ }
+ return end
+}
+
+// Parse parses the given BCP 47 string and returns a valid Tag. If parsing
+// failed it returns an error and any part of the tag that could be parsed.
+// If parsing succeeded but an unknown value was found, it returns
+// ValueError. The Tag returned in this case is just stripped of the unknown
+// value. All other values are preserved. It accepts tags in the BCP 47 format
+// and extensions to this standard defined in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+func Parse(s string) (t Tag, err error) {
+ // TODO: consider supporting old-style locale key-value pairs.
+ if s == "" {
+ return Und, ErrSyntax
+ }
+ defer func() {
+ if recover() != nil {
+ t = Und
+ err = ErrSyntax
+ return
+ }
+ }()
+ if len(s) <= maxAltTaglen {
+ b := [maxAltTaglen]byte{}
+ for i, c := range s {
+ // Generating invalid UTF-8 is okay as it won't match.
+ if 'A' <= c && c <= 'Z' {
+ c += 'a' - 'A'
+ } else if c == '_' {
+ c = '-'
+ }
+ b[i] = byte(c)
+ }
+ if t, ok := grandfathered(b); ok {
+ return t, nil
+ }
+ }
+ scan := makeScannerString(s)
+ return parse(&scan, s)
+}
+
+func parse(scan *scanner, s string) (t Tag, err error) {
+ t = Und
+ var end int
+ if n := len(scan.token); n <= 1 {
+ scan.toLower(0, len(scan.b))
+ if n == 0 || scan.token[0] != 'x' {
+ return t, ErrSyntax
+ }
+ end = parseExtensions(scan)
+ } else if n >= 4 {
+ return Und, ErrSyntax
+ } else { // the usual case
+ t, end = parseTag(scan, true)
+ if n := len(scan.token); n == 1 {
+ t.pExt = uint16(end)
+ end = parseExtensions(scan)
+ } else if end < len(scan.b) {
+ scan.setError(ErrSyntax)
+ scan.b = scan.b[:end]
+ }
+ }
+ if int(t.pVariant) < len(scan.b) {
+ if end < len(s) {
+ s = s[:end]
+ }
+ if len(s) > 0 && tag.Compare(s, scan.b) == 0 {
+ t.str = s
+ } else {
+ t.str = string(scan.b)
+ }
+ } else {
+ t.pVariant, t.pExt = 0, 0
+ }
+ return t, scan.err
+}
+
+// parseTag parses language, script, region and variants.
+// It returns a Tag and the end position in the input that was parsed.
+// If doNorm is true, then <lang>-<extlang> will be normalized to <extlang>.
+func parseTag(scan *scanner, doNorm bool) (t Tag, end int) {
+ var e error
+ // TODO: set an error if an unknown lang, script or region is encountered.
+ t.LangID, e = getLangID(scan.token)
+ scan.setError(e)
+ scan.replace(t.LangID.String())
+ langStart := scan.start
+ end = scan.scan()
+ for len(scan.token) == 3 && isAlpha(scan.token[0]) {
+ // From http://tools.ietf.org/html/bcp47, <lang>-<extlang> tags are equivalent
+ // to a tag of the form <extlang>.
+ if doNorm {
+ lang, e := getLangID(scan.token)
+ if lang != 0 {
+ t.LangID = lang
+ langStr := lang.String()
+ copy(scan.b[langStart:], langStr)
+ scan.b[langStart+len(langStr)] = '-'
+ scan.start = langStart + len(langStr) + 1
+ }
+ scan.gobble(e)
+ }
+ end = scan.scan()
+ }
+ if len(scan.token) == 4 && isAlpha(scan.token[0]) {
+ t.ScriptID, e = getScriptID(script, scan.token)
+ if t.ScriptID == 0 {
+ scan.gobble(e)
+ }
+ end = scan.scan()
+ }
+ if n := len(scan.token); n >= 2 && n <= 3 {
+ t.RegionID, e = getRegionID(scan.token)
+ if t.RegionID == 0 {
+ scan.gobble(e)
+ } else {
+ scan.replace(t.RegionID.String())
+ }
+ end = scan.scan()
+ }
+ scan.toLower(scan.start, len(scan.b))
+ t.pVariant = byte(end)
+ end = parseVariants(scan, end, t)
+ t.pExt = uint16(end)
+ return t, end
+}
+
+var separator = []byte{'-'}
+
+// parseVariants scans tokens as long as each token is a valid variant string.
+// Duplicate variants are removed.
+func parseVariants(scan *scanner, end int, t Tag) int {
+ start := scan.start
+ varIDBuf := [4]uint8{}
+ variantBuf := [4][]byte{}
+ varID := varIDBuf[:0]
+ variant := variantBuf[:0]
+ last := -1
+ needSort := false
+ for ; len(scan.token) >= 4; scan.scan() {
+ // TODO: measure the impact of needing this conversion and redesign
+ // the data structure if there is an issue.
+ v, ok := variantIndex[string(scan.token)]
+ if !ok {
+ // unknown variant
+ // TODO: allow user-defined variants?
+ scan.gobble(NewValueError(scan.token))
+ continue
+ }
+ varID = append(varID, v)
+ variant = append(variant, scan.token)
+ if !needSort {
+ if last < int(v) {
+ last = int(v)
+ } else {
+ needSort = true
+ // There is no legal combinations of more than 7 variants
+ // (and this is by no means a useful sequence).
+ const maxVariants = 8
+ if len(varID) > maxVariants {
+ break
+ }
+ }
+ }
+ end = scan.end
+ }
+ if needSort {
+ sort.Sort(variantsSort{varID, variant})
+ k, l := 0, -1
+ for i, v := range varID {
+ w := int(v)
+ if l == w {
+ // Remove duplicates.
+ continue
+ }
+ varID[k] = varID[i]
+ variant[k] = variant[i]
+ k++
+ l = w
+ }
+ if str := bytes.Join(variant[:k], separator); len(str) == 0 {
+ end = start - 1
+ } else {
+ scan.resizeRange(start, end, len(str))
+ copy(scan.b[scan.start:], str)
+ end = scan.end
+ }
+ }
+ return end
+}
+
+type variantsSort struct {
+ i []uint8
+ v [][]byte
+}
+
+func (s variantsSort) Len() int {
+ return len(s.i)
+}
+
+func (s variantsSort) Swap(i, j int) {
+ s.i[i], s.i[j] = s.i[j], s.i[i]
+ s.v[i], s.v[j] = s.v[j], s.v[i]
+}
+
+func (s variantsSort) Less(i, j int) bool {
+ return s.i[i] < s.i[j]
+}
+
+type bytesSort struct {
+ b [][]byte
+ n int // first n bytes to compare
+}
+
+func (b bytesSort) Len() int {
+ return len(b.b)
+}
+
+func (b bytesSort) Swap(i, j int) {
+ b.b[i], b.b[j] = b.b[j], b.b[i]
+}
+
+func (b bytesSort) Less(i, j int) bool {
+ for k := 0; k < b.n; k++ {
+ if b.b[i][k] == b.b[j][k] {
+ continue
+ }
+ return b.b[i][k] < b.b[j][k]
+ }
+ return false
+}
+
+// parseExtensions parses and normalizes the extensions in the buffer.
+// It returns the last position of scan.b that is part of any extension.
+// It also trims scan.b to remove excess parts accordingly.
+func parseExtensions(scan *scanner) int {
+ start := scan.start
+ exts := [][]byte{}
+ private := []byte{}
+ end := scan.end
+ for len(scan.token) == 1 {
+ extStart := scan.start
+ ext := scan.token[0]
+ end = parseExtension(scan)
+ extension := scan.b[extStart:end]
+ if len(extension) < 3 || (ext != 'x' && len(extension) < 4) {
+ scan.setError(ErrSyntax)
+ end = extStart
+ continue
+ } else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) {
+ scan.b = scan.b[:end]
+ return end
+ } else if ext == 'x' {
+ private = extension
+ break
+ }
+ exts = append(exts, extension)
+ }
+ sort.Sort(bytesSort{exts, 1})
+ if len(private) > 0 {
+ exts = append(exts, private)
+ }
+ scan.b = scan.b[:start]
+ if len(exts) > 0 {
+ scan.b = append(scan.b, bytes.Join(exts, separator)...)
+ } else if start > 0 {
+ // Strip trailing '-'.
+ scan.b = scan.b[:start-1]
+ }
+ return end
+}
+
+// parseExtension parses a single extension and returns the position of
+// the extension end.
+func parseExtension(scan *scanner) int {
+ start, end := scan.start, scan.end
+ switch scan.token[0] {
+ case 'u': // https://www.ietf.org/rfc/rfc6067.txt
+ attrStart := end
+ scan.scan()
+ for last := []byte{}; len(scan.token) > 2; scan.scan() {
+ if bytes.Compare(scan.token, last) != -1 {
+ // Attributes are unsorted. Start over from scratch.
+ p := attrStart + 1
+ scan.next = p
+ attrs := [][]byte{}
+ for scan.scan(); len(scan.token) > 2; scan.scan() {
+ attrs = append(attrs, scan.token)
+ end = scan.end
+ }
+ sort.Sort(bytesSort{attrs, 3})
+ copy(scan.b[p:], bytes.Join(attrs, separator))
+ break
+ }
+ last = scan.token
+ end = scan.end
+ }
+ // Scan key-type sequences. A key is of length 2 and may be followed
+ // by 0 or more "type" subtags from 3 to the maximum of 8 letters.
+ var last, key []byte
+ for attrEnd := end; len(scan.token) == 2; last = key {
+ key = scan.token
+ end = scan.end
+ for scan.scan(); end < scan.end && len(scan.token) > 2; scan.scan() {
+ end = scan.end
+ }
+ // TODO: check key value validity
+ if bytes.Compare(key, last) != 1 || scan.err != nil {
+ // We have an invalid key or the keys are not sorted.
+ // Start scanning keys from scratch and reorder.
+ p := attrEnd + 1
+ scan.next = p
+ keys := [][]byte{}
+ for scan.scan(); len(scan.token) == 2; {
+ keyStart := scan.start
+ end = scan.end
+ for scan.scan(); end < scan.end && len(scan.token) > 2; scan.scan() {
+ end = scan.end
+ }
+ keys = append(keys, scan.b[keyStart:end])
+ }
+ sort.Stable(bytesSort{keys, 2})
+ if n := len(keys); n > 0 {
+ k := 0
+ for i := 1; i < n; i++ {
+ if !bytes.Equal(keys[k][:2], keys[i][:2]) {
+ k++
+ keys[k] = keys[i]
+ } else if !bytes.Equal(keys[k], keys[i]) {
+ scan.setError(ErrDuplicateKey)
+ }
+ }
+ keys = keys[:k+1]
+ }
+ reordered := bytes.Join(keys, separator)
+ if e := p + len(reordered); e < end {
+ scan.deleteRange(e, end)
+ end = e
+ }
+ copy(scan.b[p:], reordered)
+ break
+ }
+ }
+ case 't': // https://www.ietf.org/rfc/rfc6497.txt
+ scan.scan()
+ if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) {
+ _, end = parseTag(scan, false)
+ scan.toLower(start, end)
+ }
+ for len(scan.token) == 2 && !isAlpha(scan.token[1]) {
+ end = scan.acceptMinSize(3)
+ }
+ case 'x':
+ end = scan.acceptMinSize(1)
+ default:
+ end = scan.acceptMinSize(2)
+ }
+ return end
+}
+
+// getExtension returns the name, body and end position of the extension.
+func getExtension(s string, p int) (end int, ext string) {
+ if s[p] == '-' {
+ p++
+ }
+ if s[p] == 'x' {
+ return len(s), s[p:]
+ }
+ end = nextExtension(s, p)
+ return end, s[p:end]
+}
+
+// nextExtension finds the next extension within the string, searching
+// for the -<char>- pattern from position p.
+// In the fast majority of cases, language tags will have at most
+// one extension and extensions tend to be small.
+func nextExtension(s string, p int) int {
+ for n := len(s) - 3; p < n; {
+ if s[p] == '-' {
+ if s[p+2] == '-' {
+ return p
+ }
+ p += 3
+ } else {
+ p++
+ }
+ }
+ return len(s)
+}
diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go
@@ -0,0 +1,3494 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package language
+
+import "golang.org/x/text/internal/tag"
+
+// CLDRVersion is the CLDR version from which the tables in this package are derived.
+const CLDRVersion = "32"
+
+const NumLanguages = 8798
+
+const NumScripts = 261
+
+const NumRegions = 358
+
+type FromTo struct {
+ From uint16
+ To uint16
+}
+
+const nonCanonicalUnd = 1201
+const (
+ _af = 22
+ _am = 39
+ _ar = 58
+ _az = 88
+ _bg = 126
+ _bn = 165
+ _ca = 215
+ _cs = 250
+ _da = 257
+ _de = 269
+ _el = 310
+ _en = 313
+ _es = 318
+ _et = 320
+ _fa = 328
+ _fi = 337
+ _fil = 339
+ _fr = 350
+ _gu = 420
+ _he = 444
+ _hi = 446
+ _hr = 465
+ _hu = 469
+ _hy = 471
+ _id = 481
+ _is = 504
+ _it = 505
+ _ja = 512
+ _ka = 528
+ _kk = 578
+ _km = 586
+ _kn = 593
+ _ko = 596
+ _ky = 650
+ _lo = 696
+ _lt = 704
+ _lv = 711
+ _mk = 767
+ _ml = 772
+ _mn = 779
+ _mo = 784
+ _mr = 795
+ _ms = 799
+ _mul = 806
+ _my = 817
+ _nb = 839
+ _ne = 849
+ _nl = 871
+ _no = 879
+ _pa = 925
+ _pl = 947
+ _pt = 960
+ _ro = 988
+ _ru = 994
+ _sh = 1031
+ _si = 1036
+ _sk = 1042
+ _sl = 1046
+ _sq = 1073
+ _sr = 1074
+ _sv = 1092
+ _sw = 1093
+ _ta = 1104
+ _te = 1121
+ _th = 1131
+ _tl = 1146
+ _tn = 1152
+ _tr = 1162
+ _uk = 1198
+ _ur = 1204
+ _uz = 1212
+ _vi = 1219
+ _zh = 1321
+ _zu = 1327
+ _jbo = 515
+ _ami = 1650
+ _bnn = 2357
+ _hak = 438
+ _tlh = 14467
+ _lb = 661
+ _nv = 899
+ _pwn = 12055
+ _tao = 14188
+ _tay = 14198
+ _tsu = 14662
+ _nn = 874
+ _sfb = 13629
+ _vgt = 15701
+ _sgg = 13660
+ _cmn = 3007
+ _nan = 835
+ _hsn = 467
+)
+
+const langPrivateStart = 0x2f72
+
+const langPrivateEnd = 0x3179
+
+// lang holds an alphabetically sorted list of ISO-639 language identifiers.
+// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
+// For 2-byte language identifiers, the two successive bytes have the following meaning:
+// - if the first letter of the 2- and 3-letter ISO codes are the same:
+// the second and third letter of the 3-letter ISO code.
+// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
+//
+// For 3-byte language identifiers the 4th byte is 0.
+const lang tag.Index = "" + // Size: 5324 bytes
+ "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" +
+ "cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" +
+ "\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" +
+ "jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" +
+ "p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" +
+ "ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" +
+ "\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" +
+ "tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" +
+ "\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" +
+ "bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" +
+ "m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" +
+ "bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" +
+ "\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" +
+ "\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" +
+ "\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" +
+ "\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" +
+ "bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" +
+ "\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" +
+ "uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" +
+ "\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" +
+ "\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" +
+ "\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" +
+ "kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" +
+ "j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" +
+ "andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" +
+ "ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" +
+ "\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" +
+ "\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" +
+ "yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" +
+ "llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" +
+ "\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" +
+ "\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" +
+ "foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" +
+ "ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" +
+ "ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" +
+ "\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" +
+ "ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" +
+ "\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" +
+ "\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" +
+ "\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" +
+ "\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" +
+ "aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" +
+ "l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" +
+ "hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" +
+ "\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" +
+ "eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" +
+ "lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" +
+ "ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" +
+ "\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" +
+ "\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" +
+ "\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" +
+ "\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" +
+ "ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" +
+ "\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" +
+ "klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" +
+ "nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" +
+ "\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" +
+ "rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" +
+ "\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" +
+ "us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" +
+ "\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" +
+ "\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" +
+ "ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" +
+ "d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" +
+ "\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" +
+ "\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" +
+ "lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" +
+ "w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" +
+ "\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" +
+ "\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" +
+ "\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" +
+ "min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" +
+ "ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" +
+ "e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" +
+ "mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" +
+ "us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" +
+ "\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" +
+ "\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" +
+ "bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" +
+ "\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" +
+ "if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" +
+ "dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" +
+ "nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" +
+ "\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" +
+ "\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" +
+ "opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" +
+ "\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" +
+ "\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" +
+ "\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" +
+ "ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" +
+ "f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" +
+ "rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" +
+ "ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" +
+ "\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" +
+ "ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" +
+ "i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" +
+ "\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" +
+ "\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" +
+ "\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" +
+ "\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" +
+ "\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" +
+ "sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" +
+ "yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" +
+ "\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" +
+ "ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" +
+ "q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" +
+ "\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" +
+ "tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" +
+ "sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" +
+ "\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" +
+ "wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" +
+ "\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" +
+ "vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" +
+ "\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" +
+ "\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" +
+ "\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" +
+ "\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" +
+ "bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" +
+ "\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" +
+ "\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" +
+ "\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" +
+ "ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" +
+ "\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" +
+ "\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff"
+
+const langNoIndexOffset = 1330
+
+// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
+// in lookup tables. The language ids for these language codes are derived directly
+// from the letters and are not consecutive.
+// Size: 2197 bytes, 2197 elements
+var langNoIndex = [2197]uint8{
+ // Entry 0 - 3F
+ 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2,
+ 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57,
+ 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70,
+ 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x72,
+ 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77,
+ 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2,
+ 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xbc, 0x0a, 0x6a,
+ 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff,
+ // Entry 40 - 7F
+ 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0,
+ 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed,
+ 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35,
+ 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff,
+ 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5,
+ 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3,
+ 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce,
+ 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf,
+ // Entry 80 - BF
+ 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x7f, 0xff, 0xff,
+ 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7,
+ 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba,
+ 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff,
+ 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff,
+ 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5,
+ 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c,
+ 0x08, 0x21, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80,
+ // Entry C0 - FF
+ 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96,
+ 0x1b, 0x14, 0x08, 0xf3, 0x2b, 0xe7, 0x17, 0x56,
+ 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7f, 0xf3, 0xef,
+ 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10,
+ 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xff, 0x7b, 0x35,
+ 0x3e, 0xc7, 0xc7, 0xdf, 0xff, 0x01, 0x81, 0x00,
+ 0xb0, 0x05, 0x80, 0x00, 0x20, 0x00, 0x00, 0x03,
+ 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d,
+ // Entry 100 - 13F
+ 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64,
+ 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00,
+ 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3,
+ 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x41, 0x0c,
+ 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc7, 0x67, 0x5f,
+ 0x56, 0x99, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00,
+ 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56,
+ 0x90, 0x6d, 0x01, 0x2e, 0x96, 0x69, 0x20, 0xfb,
+ // Entry 140 - 17F
+ 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x0c, 0x16,
+ 0x03, 0x00, 0x00, 0xb0, 0x14, 0x23, 0x50, 0x06,
+ 0x0a, 0x00, 0x01, 0x00, 0x00, 0x10, 0x11, 0x09,
+ 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10,
+ 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x05,
+ 0x08, 0x00, 0x00, 0x05, 0x00, 0x80, 0x28, 0x04,
+ 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35,
+ 0x24, 0x52, 0xf4, 0xd5, 0xbf, 0x62, 0xc9, 0x03,
+ // Entry 180 - 1BF
+ 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98,
+ 0x21, 0x18, 0x81, 0x08, 0x00, 0x01, 0x40, 0x82,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea,
+ 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00,
+ // Entry 1C0 - 1FF
+ 0x00, 0x03, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00,
+ 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00,
+ 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55,
+ 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40,
+ 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf,
+ // Entry 200 - 23F
+ 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27,
+ 0xed, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5,
+ 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe1, 0xdf,
+ 0x03, 0x44, 0x08, 0x90, 0x01, 0x04, 0x81, 0xe3,
+ 0x92, 0x54, 0xdb, 0x28, 0xd3, 0x5f, 0xfe, 0x6d,
+ 0x79, 0xed, 0x1c, 0x7f, 0x04, 0x08, 0x00, 0x01,
+ 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f,
+ 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54,
+ // Entry 240 - 27F
+ 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00,
+ 0x20, 0x7b, 0x78, 0x02, 0x07, 0x84, 0x00, 0xf0,
+ 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00,
+ 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04,
+ 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00,
+ 0x91, 0x24, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff,
+ 0x7b, 0x7f, 0x70, 0x00, 0x05, 0x9b, 0xdd, 0x66,
+ // Entry 280 - 2BF
+ 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05,
+ 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51,
+ 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05,
+ 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
+ 0x0c, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60,
+ 0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80,
+ 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04,
+ 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20,
+ // Entry 2C0 - 2FF
+ 0x02, 0x50, 0x80, 0x11, 0x00, 0x99, 0x6c, 0xe2,
+ 0x50, 0x27, 0x1d, 0x11, 0x29, 0x0e, 0x59, 0xe9,
+ 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00,
+ 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d,
+ 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00,
+ 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01,
+ 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x40, 0x08,
+ 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x8d, 0x12, 0x00,
+ // Entry 300 - 33F
+ 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0,
+ 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00,
+ 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80,
+ 0x00, 0x01, 0xd0, 0x16, 0x40, 0x00, 0x10, 0xb0,
+ 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00,
+ 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80,
+ 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00,
+ 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00,
+ // Entry 340 - 37F
+ 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01,
+ 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3,
+ 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb,
+ 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6,
+ 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff,
+ 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff,
+ 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f,
+ 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f,
+ // Entry 380 - 3BF
+ 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f,
+ 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d,
+ 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf,
+ 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff,
+ 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb,
+ 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe,
+ 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x7d, 0x1f,
+ 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44,
+ // Entry 3C0 - 3FF
+ 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57,
+ 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7,
+ 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x20,
+ 0x40, 0x54, 0x9f, 0x8a, 0xdf, 0xf9, 0x6e, 0x11,
+ 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x03,
+ 0x05, 0xd1, 0x50, 0x5c, 0x00, 0x40, 0x00, 0x10,
+ 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2,
+ 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe,
+ // Entry 400 - 43F
+ 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f,
+ 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7,
+ 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f,
+ 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b,
+ 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7,
+ 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe,
+ 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde,
+ 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf,
+ // Entry 440 - 47F
+ 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d,
+ 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd,
+ 0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf,
+ 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7,
+ 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce,
+ 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xfd,
+ 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff,
+ 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4,
+ // Entry 480 - 4BF
+ 0x93, 0x50, 0x5d, 0xaf, 0xa6, 0xff, 0x99, 0xfb,
+ 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20,
+ 0x14, 0x00, 0x55, 0x51, 0xc2, 0x65, 0xf5, 0x41,
+ 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x85, 0xc5, 0x05,
+ 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x05,
+ 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00,
+ 0x06, 0x11, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1,
+ // Entry 4C0 - 4FF
+ 0xfd, 0x47, 0x69, 0x06, 0x95, 0x06, 0x57, 0xed,
+ 0xfb, 0x4d, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40,
+ 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83,
+ 0xb8, 0x4f, 0x10, 0x8e, 0x89, 0x46, 0xde, 0xf7,
+ 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00,
+ 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d,
+ 0xbe, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41,
+ // Entry 500 - 53F
+ 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49,
+ 0x2d, 0x14, 0x27, 0x5f, 0xed, 0xf1, 0x3f, 0xe7,
+ 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8,
+ 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe7, 0xf7,
+ 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10,
+ 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9,
+ 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c,
+ 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40,
+ // Entry 540 - 57F
+ 0x00, 0x00, 0x01, 0x43, 0x19, 0x24, 0x08, 0x00,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ // Entry 580 - 5BF
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d,
+ 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80,
+ 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf,
+ 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00,
+ 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00,
+ 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x20, 0x81,
+ 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40,
+ // Entry 5C0 - 5FF
+ 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0xbe, 0x02,
+ 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20,
+ 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02,
+ 0x3d, 0x40, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d,
+ 0x31, 0x00, 0x00, 0x00, 0x01, 0x18, 0x02, 0x20,
+ 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00,
+ 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f,
+ 0x1f, 0x98, 0xcf, 0x9c, 0xff, 0xaf, 0x5f, 0xfe,
+ // Entry 600 - 63F
+ 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9,
+ 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1,
+ 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7,
+ 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd,
+ 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x9f,
+ 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe,
+ 0xbe, 0x5f, 0x46, 0x5b, 0xe9, 0x5f, 0x50, 0x18,
+ 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f,
+ // Entry 640 - 67F
+ 0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf5, 0x57, 0x6c,
+ 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde,
+ 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x3f, 0x00, 0x98,
+ 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff,
+ 0xb9, 0xda, 0x7d, 0xd0, 0x3e, 0x15, 0x7b, 0xb4,
+ 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7,
+ 0x5f, 0xff, 0xff, 0x9e, 0xdf, 0xf6, 0xd7, 0xb9,
+ 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3,
+ // Entry 680 - 6BF
+ 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37,
+ 0xce, 0x7f, 0x44, 0x1d, 0x73, 0x7f, 0xf8, 0xda,
+ 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x79, 0xa0,
+ 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08,
+ 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00,
+ 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x09, 0x06,
+ 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00,
+ 0x04, 0x00, 0x10, 0xdc, 0x58, 0xd7, 0x0d, 0x0f,
+ // Entry 6C0 - 6FF
+ 0x54, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08,
+ 0x40, 0x02, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00,
+ 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x48, 0x41,
+ 0x24, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00,
+ 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab,
+ 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00,
+ // Entry 700 - 73F
+ 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00,
+ 0x80, 0x86, 0xc2, 0x00, 0x00, 0x01, 0x00, 0x01,
+ 0xff, 0x18, 0x02, 0x00, 0x02, 0xf0, 0xfd, 0x79,
+ 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00,
+ 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00,
+ 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 740 - 77F
+ 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e,
+ 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x46,
+ 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04,
+ 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a,
+ 0x01, 0x00, 0x00, 0xb0, 0x80, 0x20, 0x55, 0x75,
+ 0x97, 0x7c, 0xdf, 0x31, 0xcc, 0x68, 0xd1, 0x03,
+ 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60,
+ // Entry 780 - 7BF
+ 0x83, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01,
+ 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00,
+ 0x10, 0x03, 0x31, 0x02, 0x01, 0x00, 0x00, 0xf0,
+ 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78,
+ 0x78, 0x15, 0x50, 0x05, 0xa4, 0x84, 0xa9, 0x41,
+ 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x40,
+ 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02,
+ 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed,
+ // Entry 7C0 - 7FF
+ 0xdd, 0xbf, 0xf2, 0x5d, 0xc7, 0x0c, 0xd5, 0x42,
+ 0xfc, 0xff, 0xf7, 0x1f, 0x00, 0x80, 0x40, 0x56,
+ 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff,
+ 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d,
+ 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80,
+ 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60,
+ 0xfe, 0x01, 0x02, 0x88, 0x2a, 0x40, 0x16, 0x01,
+ 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10,
+ // Entry 800 - 83F
+ 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf,
+ 0xbf, 0x03, 0x00, 0x00, 0x10, 0xdc, 0xa3, 0xd1,
+ 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3,
+ 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80,
+ 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84,
+ 0x2f, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93,
+ 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10,
+ 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00,
+ // Entry 840 - 87F
+ 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x89,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x03,
+ 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28,
+ 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00,
+ 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x54, 0xf1,
+ 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50,
+ 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40,
+ 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1,
+ // Entry 880 - 8BF
+ 0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00,
+ 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24,
+ 0x0a, 0x00, 0x80, 0x00, 0x00,
+}
+
+// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
+// to 2-letter language codes that cannot be derived using the method described above.
+// Each 3-letter code is followed by its 1-byte langID.
+const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff"
+
+// altLangIndex is used to convert indexes in altLangISO3 to langIDs.
+// Size: 12 bytes, 6 elements
+var altLangIndex = [6]uint16{
+ 0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208,
+}
+
+// AliasMap maps langIDs to their suggested replacements.
+// Size: 772 bytes, 193 elements
+var AliasMap = [193]FromTo{
+ 0: {From: 0x82, To: 0x88},
+ 1: {From: 0x187, To: 0x1ae},
+ 2: {From: 0x1f3, To: 0x1e1},
+ 3: {From: 0x1fb, To: 0x1bc},
+ 4: {From: 0x208, To: 0x512},
+ 5: {From: 0x20f, To: 0x20e},
+ 6: {From: 0x310, To: 0x3dc},
+ 7: {From: 0x347, To: 0x36f},
+ 8: {From: 0x407, To: 0x432},
+ 9: {From: 0x47a, To: 0x153},
+ 10: {From: 0x490, To: 0x451},
+ 11: {From: 0x4a2, To: 0x21},
+ 12: {From: 0x53e, To: 0x544},
+ 13: {From: 0x58f, To: 0x12d},
+ 14: {From: 0x62b, To: 0x34},
+ 15: {From: 0x62f, To: 0x14},
+ 16: {From: 0x630, To: 0x1eb1},
+ 17: {From: 0x651, To: 0x431},
+ 18: {From: 0x662, To: 0x431},
+ 19: {From: 0x6ed, To: 0x3a},
+ 20: {From: 0x6f8, To: 0x1d7},
+ 21: {From: 0x709, To: 0x3625},
+ 22: {From: 0x73e, To: 0x21a1},
+ 23: {From: 0x7b3, To: 0x56},
+ 24: {From: 0x7b9, To: 0x299b},
+ 25: {From: 0x7c5, To: 0x58},
+ 26: {From: 0x7e6, To: 0x145},
+ 27: {From: 0x80c, To: 0x5a},
+ 28: {From: 0x815, To: 0x8d},
+ 29: {From: 0x87e, To: 0x810},
+ 30: {From: 0x8a8, To: 0x8b7},
+ 31: {From: 0x8c3, To: 0xee3},
+ 32: {From: 0x8fa, To: 0x1dc},
+ 33: {From: 0x9ef, To: 0x331},
+ 34: {From: 0xa36, To: 0x2c5},
+ 35: {From: 0xa3d, To: 0xbf},
+ 36: {From: 0xabe, To: 0x3322},
+ 37: {From: 0xb38, To: 0x529},
+ 38: {From: 0xb75, To: 0x265a},
+ 39: {From: 0xb7e, To: 0xbc3},
+ 40: {From: 0xb9b, To: 0x44e},
+ 41: {From: 0xbbc, To: 0x4229},
+ 42: {From: 0xbbf, To: 0x529},
+ 43: {From: 0xbfe, To: 0x2da7},
+ 44: {From: 0xc2e, To: 0x3181},
+ 45: {From: 0xcb9, To: 0xf3},
+ 46: {From: 0xd08, To: 0xfa},
+ 47: {From: 0xdc8, To: 0x11a},
+ 48: {From: 0xdd7, To: 0x32d},
+ 49: {From: 0xdf8, To: 0xdfb},
+ 50: {From: 0xdfe, To: 0x531},
+ 51: {From: 0xe01, To: 0xdf3},
+ 52: {From: 0xedf, To: 0x205a},
+ 53: {From: 0xee9, To: 0x222e},
+ 54: {From: 0xeee, To: 0x2e9a},
+ 55: {From: 0xf39, To: 0x367},
+ 56: {From: 0x10d0, To: 0x140},
+ 57: {From: 0x1104, To: 0x2d0},
+ 58: {From: 0x11a0, To: 0x1ec},
+ 59: {From: 0x1279, To: 0x21},
+ 60: {From: 0x1424, To: 0x15e},
+ 61: {From: 0x1470, To: 0x14e},
+ 62: {From: 0x151f, To: 0xd9b},
+ 63: {From: 0x1523, To: 0x390},
+ 64: {From: 0x1532, To: 0x19f},
+ 65: {From: 0x1580, To: 0x210},
+ 66: {From: 0x1583, To: 0x10d},
+ 67: {From: 0x15a3, To: 0x3caf},
+ 68: {From: 0x1630, To: 0x222e},
+ 69: {From: 0x166a, To: 0x19b},
+ 70: {From: 0x16c8, To: 0x136},
+ 71: {From: 0x1700, To: 0x29f8},
+ 72: {From: 0x1718, To: 0x194},
+ 73: {From: 0x1727, To: 0xf3f},
+ 74: {From: 0x177a, To: 0x178},
+ 75: {From: 0x1809, To: 0x17b6},
+ 76: {From: 0x1816, To: 0x18f3},
+ 77: {From: 0x188a, To: 0x436},
+ 78: {From: 0x1979, To: 0x1d01},
+ 79: {From: 0x1a74, To: 0x2bb0},
+ 80: {From: 0x1a8a, To: 0x1f8},
+ 81: {From: 0x1b5a, To: 0x1fa},
+ 82: {From: 0x1b86, To: 0x1515},
+ 83: {From: 0x1d64, To: 0x2c9b},
+ 84: {From: 0x2038, To: 0x37b1},
+ 85: {From: 0x203d, To: 0x20dd},
+ 86: {From: 0x2042, To: 0x2e00},
+ 87: {From: 0x205a, To: 0x30b},
+ 88: {From: 0x20e3, To: 0x274},
+ 89: {From: 0x20ee, To: 0x263},
+ 90: {From: 0x20f2, To: 0x22d},
+ 91: {From: 0x20f9, To: 0x256},
+ 92: {From: 0x210f, To: 0x21eb},
+ 93: {From: 0x2135, To: 0x27d},
+ 94: {From: 0x2160, To: 0x913},
+ 95: {From: 0x2199, To: 0x121},
+ 96: {From: 0x21ce, To: 0x1561},
+ 97: {From: 0x21e6, To: 0x504},
+ 98: {From: 0x21f4, To: 0x49f},
+ 99: {From: 0x21fb, To: 0x269},
+ 100: {From: 0x222d, To: 0x121},
+ 101: {From: 0x2237, To: 0x121},
+ 102: {From: 0x2248, To: 0x217d},
+ 103: {From: 0x2262, To: 0x92a},
+ 104: {From: 0x2316, To: 0x3226},
+ 105: {From: 0x236a, To: 0x2835},
+ 106: {From: 0x2382, To: 0x3365},
+ 107: {From: 0x2472, To: 0x2c7},
+ 108: {From: 0x24e4, To: 0x2ff},
+ 109: {From: 0x24f0, To: 0x2fa},
+ 110: {From: 0x24fa, To: 0x31f},
+ 111: {From: 0x2550, To: 0xb5b},
+ 112: {From: 0x25a9, To: 0xe2},
+ 113: {From: 0x263e, To: 0x2d0},
+ 114: {From: 0x26c9, To: 0x26b4},
+ 115: {From: 0x26f9, To: 0x3c8},
+ 116: {From: 0x2727, To: 0x3caf},
+ 117: {From: 0x2755, To: 0x6a4},
+ 118: {From: 0x2765, To: 0x26b4},
+ 119: {From: 0x2789, To: 0x4358},
+ 120: {From: 0x27c9, To: 0x2001},
+ 121: {From: 0x28ea, To: 0x27b1},
+ 122: {From: 0x28ef, To: 0x2837},
+ 123: {From: 0x28fe, To: 0xaa5},
+ 124: {From: 0x2914, To: 0x351},
+ 125: {From: 0x2986, To: 0x2da7},
+ 126: {From: 0x29f0, To: 0x96b},
+ 127: {From: 0x2b1a, To: 0x38d},
+ 128: {From: 0x2bfc, To: 0x395},
+ 129: {From: 0x2c3f, To: 0x3caf},
+ 130: {From: 0x2ce1, To: 0x2201},
+ 131: {From: 0x2cfc, To: 0x3be},
+ 132: {From: 0x2d13, To: 0x597},
+ 133: {From: 0x2d47, To: 0x148},
+ 134: {From: 0x2d48, To: 0x148},
+ 135: {From: 0x2dff, To: 0x2f1},
+ 136: {From: 0x2e08, To: 0x19cc},
+ 137: {From: 0x2e10, To: 0xc45},
+ 138: {From: 0x2e1a, To: 0x2d95},
+ 139: {From: 0x2e21, To: 0x292},
+ 140: {From: 0x2e54, To: 0x7d},
+ 141: {From: 0x2e65, To: 0x2282},
+ 142: {From: 0x2e97, To: 0x1a4},
+ 143: {From: 0x2ea0, To: 0x2e9b},
+ 144: {From: 0x2eef, To: 0x2ed7},
+ 145: {From: 0x3193, To: 0x3c4},
+ 146: {From: 0x3366, To: 0x338e},
+ 147: {From: 0x342a, To: 0x3dc},
+ 148: {From: 0x34ee, To: 0x18d0},
+ 149: {From: 0x35c8, To: 0x2c9b},
+ 150: {From: 0x35e6, To: 0x412},
+ 151: {From: 0x35f5, To: 0x24b},
+ 152: {From: 0x360d, To: 0x1dc},
+ 153: {From: 0x3658, To: 0x246},
+ 154: {From: 0x3676, To: 0x3f4},
+ 155: {From: 0x36fd, To: 0x445},
+ 156: {From: 0x3747, To: 0x3b42},
+ 157: {From: 0x37c0, To: 0x121},
+ 158: {From: 0x3816, To: 0x38f2},
+ 159: {From: 0x382a, To: 0x2b48},
+ 160: {From: 0x382b, To: 0x2c9b},
+ 161: {From: 0x382f, To: 0xa9},
+ 162: {From: 0x3832, To: 0x3228},
+ 163: {From: 0x386c, To: 0x39a6},
+ 164: {From: 0x3892, To: 0x3fc0},
+ 165: {From: 0x38a0, To: 0x45f},
+ 166: {From: 0x38a5, To: 0x39d7},
+ 167: {From: 0x38b4, To: 0x1fa4},
+ 168: {From: 0x38b5, To: 0x2e9a},
+ 169: {From: 0x38fa, To: 0x38f1},
+ 170: {From: 0x395c, To: 0x47e},
+ 171: {From: 0x3b4e, To: 0xd91},
+ 172: {From: 0x3b78, To: 0x137},
+ 173: {From: 0x3c99, To: 0x4bc},
+ 174: {From: 0x3fbd, To: 0x100},
+ 175: {From: 0x4208, To: 0xa91},
+ 176: {From: 0x42be, To: 0x573},
+ 177: {From: 0x42f9, To: 0x3f60},
+ 178: {From: 0x4378, To: 0x25a},
+ 179: {From: 0x43b8, To: 0xe6c},
+ 180: {From: 0x43cd, To: 0x10f},
+ 181: {From: 0x43d4, To: 0x4848},
+ 182: {From: 0x44af, To: 0x3322},
+ 183: {From: 0x44e3, To: 0x512},
+ 184: {From: 0x45ca, To: 0x2409},
+ 185: {From: 0x45dd, To: 0x26dc},
+ 186: {From: 0x4610, To: 0x48ae},
+ 187: {From: 0x46ae, To: 0x46a0},
+ 188: {From: 0x473e, To: 0x4745},
+ 189: {From: 0x4817, To: 0x3503},
+ 190: {From: 0x483b, To: 0x208b},
+ 191: {From: 0x4916, To: 0x31f},
+ 192: {From: 0x49a7, To: 0x523},
+}
+
+// Size: 193 bytes, 193 elements
+var AliasTypes = [193]AliasType{
+ // Entry 0 - 3F
+ 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 0, 0,
+ 1, 2, 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0,
+ 0, 2, 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1,
+ 1, 1, 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1,
+ // Entry 40 - 7F
+ 1, 2, 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0,
+ 2, 1, 0, 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0,
+ 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1,
+ // Entry 80 - BF
+ 1, 0, 0, 1, 0, 2, 1, 1, 0, 0, 0, 1, 0, 0, 0, 0,
+ 0, 1, 1, 2, 0, 0, 2, 0, 0, 1, 1, 1, 0, 0, 0, 0,
+ 0, 2, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 0, 1, 2, 0,
+ 0, 0, 1, 0, 1, 0, 0, 1, 0, 0, 0, 0, 1, 0, 0, 1,
+ // Entry C0 - FF
+ 1,
+}
+
+const (
+ _Latn = 91
+ _Hani = 57
+ _Hans = 59
+ _Hant = 60
+ _Qaaa = 149
+ _Qaai = 157
+ _Qabx = 198
+ _Zinh = 255
+ _Zyyy = 260
+ _Zzzz = 261
+)
+
+// script is an alphabetically sorted list of ISO 15924 codes. The index
+// of the script in the string, divided by 4, is the internal scriptID.
+const script tag.Index = "" + // Size: 1052 bytes
+ "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" +
+ "BrahBraiBugiBuhdCakmCansCariChamCherChrsCirtCoptCpmnCprtCyrlCyrsDevaDiak" +
+ "DogrDsrtDuplEgydEgyhEgypElbaElymEthiGeokGeorGlagGongGonmGothGranGrekGujr" +
+ "GuruHanbHangHaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamo" +
+ "JavaJpanJurcKaliKanaKawiKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatf" +
+ "LatgLatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedf" +
+ "MendMercMeroMlymModiMongMoonMrooMteiMultMymrNagmNandNarbNbatNewaNkdbNkgb" +
+ "NkooNshuOgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlv" +
+ "PhnxPiqdPlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaam" +
+ "QaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabe" +
+ "QabfQabgQabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabw" +
+ "QabxRanjRjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogd" +
+ "SogoSoraSoyoSundSunuSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTelu" +
+ "TengTfngTglgThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsux" +
+ "YeziYiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff"
+
+// suppressScript is an index from langID to the dominant script for that language,
+// if it exists. If a script is given, it should be suppressed from the language tag.
+// Size: 1330 bytes, 1330 elements
+var suppressScript = [1330]uint8{
+ // Entry 0 - 3F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 40 - 7F
+ 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00,
+ // Entry 80 - BF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry C0 - FF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 100 - 13F
+ 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xed, 0x00, 0x00, 0x00, 0x00, 0xef, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x34, 0x00,
+ 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x5b, 0x00,
+ // Entry 140 - 17F
+ 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00,
+ 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00,
+ 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00,
+ 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 180 - 1BF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x5b, 0x35, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x22, 0x00,
+ // Entry 1C0 - 1FF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x5b, 0x5b, 0x00, 0x5b, 0x5b, 0x00, 0x08,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00,
+ 0x5b, 0x5b, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00,
+ // Entry 200 - 23F
+ 0x49, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x2e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 240 - 27F
+ 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00,
+ 0x00, 0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x53, 0x00, 0x00, 0x54, 0x00, 0x22, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 280 - 2BF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00,
+ 0x58, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 2C0 - 2FF
+ 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x22, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20,
+ // Entry 300 - 33F
+ 0x00, 0x00, 0x00, 0x00, 0x6f, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5b,
+ 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x76, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00,
+ // Entry 340 - 37F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00,
+ 0x5b, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+ 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x5b, 0x00,
+ 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 380 - 3BF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x5b, 0x00, 0x00, 0x00, 0x00, 0x83, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x36, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00,
+ // Entry 3C0 - 3FF
+ 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00,
+ 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 400 - 43F
+ 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xd6, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00,
+ 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+ 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00,
+ // Entry 440 - 47F
+ 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xe6, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xe9, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xee, 0x00, 0x00, 0x00, 0x2c,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+ 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00,
+ // Entry 480 - 4BF
+ 0x5b, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00,
+ 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 4C0 - 4FF
+ 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 500 - 53F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+ 0x00, 0x00,
+}
+
+const (
+ _001 = 1
+ _419 = 31
+ _BR = 65
+ _CA = 73
+ _ES = 111
+ _GB = 124
+ _MD = 189
+ _PT = 239
+ _UK = 307
+ _US = 310
+ _ZZ = 358
+ _XA = 324
+ _XC = 326
+ _XK = 334
+)
+
+// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
+// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
+// the UN.M49 codes used for groups.)
+const isoRegionOffset = 32
+
+// regionTypes defines the status of a region for various standards.
+// Size: 359 bytes, 359 elements
+var regionTypes = [359]uint8{
+ // Entry 0 - 3F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ // Entry 40 - 7F
+ 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x04, 0x06,
+ 0x04, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x04, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00,
+ 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06,
+ // Entry 80 - BF
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ // Entry C0 - FF
+ 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x00, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04,
+ 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x00, 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05,
+ 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+ // Entry 100 - 13F
+ 0x05, 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
+ // Entry 140 - 17F
+ 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05,
+ 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+ 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+ 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06,
+ 0x06, 0x04, 0x06, 0x06, 0x04, 0x06, 0x05,
+}
+
+// regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
+// Each 2-letter codes is followed by two bytes with the following meaning:
+// - [A-Z}{2}: the first letter of the 2-letter code plus these two
+// letters form the 3-letter ISO code.
+// - 0, n: index into altRegionISO3.
+const regionISO tag.Index = "" + // Size: 1312 bytes
+ "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" +
+ "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" +
+ "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" +
+ "CQ CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADO" +
+ "OMDYHYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSM" +
+ "FOROFQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQ" +
+ "NQGRRCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERL" +
+ "ILSRIMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM" +
+ "\x00\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSO" +
+ "LTTULUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNP" +
+ "MQTQMRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLD" +
+ "NOORNPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM" +
+ "\x00\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSS" +
+ "QTTTQU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLB" +
+ "SCYCSDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXM" +
+ "SYYRSZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTT" +
+ "TOTVUVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVN" +
+ "NMVUUTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXN" +
+ "NNXOOOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUG" +
+ "ZAAFZMMBZRARZWWEZZZZ\xff\xff\xff\xff"
+
+// altRegionISO3 holds a list of 3-letter region codes that cannot be
+// mapped to 2-letter codes using the default algorithm. This is a short list.
+const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN"
+
+// altRegionIDs holds a list of regionIDs the positions of which match those
+// of the 3-letter ISO codes in altRegionISO3.
+// Size: 22 bytes, 11 elements
+var altRegionIDs = [11]uint16{
+ 0x0058, 0x0071, 0x0089, 0x00a9, 0x00ab, 0x00ae, 0x00eb, 0x0106,
+ 0x0122, 0x0160, 0x00dd,
+}
+
+// Size: 80 bytes, 20 elements
+var regionOldMap = [20]FromTo{
+ 0: {From: 0x44, To: 0xc5},
+ 1: {From: 0x59, To: 0xa8},
+ 2: {From: 0x60, To: 0x61},
+ 3: {From: 0x67, To: 0x3b},
+ 4: {From: 0x7a, To: 0x79},
+ 5: {From: 0x94, To: 0x37},
+ 6: {From: 0xa4, To: 0x134},
+ 7: {From: 0xc2, To: 0x134},
+ 8: {From: 0xd8, To: 0x140},
+ 9: {From: 0xdd, To: 0x2b},
+ 10: {From: 0xf0, To: 0x134},
+ 11: {From: 0xf3, To: 0xe3},
+ 12: {From: 0xfd, To: 0x71},
+ 13: {From: 0x104, To: 0x165},
+ 14: {From: 0x12b, To: 0x127},
+ 15: {From: 0x133, To: 0x7c},
+ 16: {From: 0x13b, To: 0x13f},
+ 17: {From: 0x142, To: 0x134},
+ 18: {From: 0x15e, To: 0x15f},
+ 19: {From: 0x164, To: 0x4b},
+}
+
+// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
+// codes indicating collections of regions.
+// Size: 718 bytes, 359 elements
+var m49 = [359]int16{
+ // Entry 0 - 3F
+ 0, 1, 2, 3, 5, 9, 11, 13,
+ 14, 15, 17, 18, 19, 21, 29, 30,
+ 34, 35, 39, 53, 54, 57, 61, 142,
+ 143, 145, 150, 151, 154, 155, 202, 419,
+ 958, 0, 20, 784, 4, 28, 660, 8,
+ 51, 530, 24, 10, 32, 16, 40, 36,
+ 533, 248, 31, 70, 52, 50, 56, 854,
+ 100, 48, 108, 204, 652, 60, 96, 68,
+ // Entry 40 - 7F
+ 535, 76, 44, 64, 104, 74, 72, 112,
+ 84, 124, 166, 180, 140, 178, 756, 384,
+ 184, 152, 120, 156, 170, 0, 0, 188,
+ 891, 296, 192, 132, 531, 162, 196, 203,
+ 278, 276, 0, 262, 208, 212, 214, 204,
+ 12, 0, 218, 233, 818, 732, 232, 724,
+ 231, 967, 0, 246, 242, 238, 583, 234,
+ 0, 250, 249, 266, 826, 308, 268, 254,
+ // Entry 80 - BF
+ 831, 288, 292, 304, 270, 324, 312, 226,
+ 300, 239, 320, 316, 624, 328, 344, 334,
+ 340, 191, 332, 348, 854, 0, 360, 372,
+ 376, 833, 356, 86, 368, 364, 352, 380,
+ 832, 388, 400, 392, 581, 404, 417, 116,
+ 296, 174, 659, 408, 410, 414, 136, 398,
+ 418, 422, 662, 438, 144, 430, 426, 440,
+ 442, 428, 434, 504, 492, 498, 499, 663,
+ // Entry C0 - FF
+ 450, 584, 581, 807, 466, 104, 496, 446,
+ 580, 474, 478, 500, 470, 480, 462, 454,
+ 484, 458, 508, 516, 540, 562, 574, 566,
+ 548, 558, 528, 578, 524, 10, 520, 536,
+ 570, 554, 512, 591, 0, 604, 258, 598,
+ 608, 586, 616, 666, 612, 630, 275, 620,
+ 581, 585, 600, 591, 634, 959, 960, 961,
+ 962, 963, 964, 965, 966, 967, 968, 969,
+ // Entry 100 - 13F
+ 970, 971, 972, 638, 716, 642, 688, 643,
+ 646, 682, 90, 690, 729, 752, 702, 654,
+ 705, 744, 703, 694, 674, 686, 706, 740,
+ 728, 678, 810, 222, 534, 760, 748, 0,
+ 796, 148, 260, 768, 764, 762, 772, 626,
+ 795, 788, 776, 626, 792, 780, 798, 158,
+ 834, 804, 800, 826, 581, 0, 840, 858,
+ 860, 336, 670, 704, 862, 92, 850, 704,
+ // Entry 140 - 17F
+ 548, 876, 581, 882, 973, 974, 975, 976,
+ 977, 978, 979, 980, 981, 982, 983, 984,
+ 985, 986, 987, 988, 989, 990, 991, 992,
+ 993, 994, 995, 996, 997, 998, 720, 887,
+ 175, 891, 710, 894, 180, 716, 999,
+}
+
+// m49Index gives indexes into fromM49 based on the three most significant bits
+// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
+//
+// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
+//
+// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
+// The region code is stored in the 9 lsb of the indexed value.
+// Size: 18 bytes, 9 elements
+var m49Index = [9]int16{
+ 0, 59, 108, 143, 181, 220, 259, 291,
+ 333,
+}
+
+// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.
+// Size: 666 bytes, 333 elements
+var fromM49 = [333]uint16{
+ // Entry 0 - 3F
+ 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b,
+ 0x1606, 0x1868, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b,
+ 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32,
+ 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039,
+ 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d,
+ 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848,
+ 0xac9b, 0xb50a, 0xb93d, 0xc03e, 0xc838, 0xd0c5, 0xd83a, 0xe047,
+ 0xe8a7, 0xf052, 0xf849, 0x085b, 0x10ae, 0x184c, 0x1c17, 0x1e18,
+ // Entry 40 - 7F
+ 0x20b4, 0x2219, 0x2921, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d,
+ 0x3853, 0x3d2f, 0x445d, 0x4c4a, 0x5454, 0x5ca9, 0x5f60, 0x644d,
+ 0x684b, 0x7050, 0x7857, 0x7e91, 0x805a, 0x885e, 0x941e, 0x965f,
+ 0x983b, 0xa064, 0xa865, 0xac66, 0xb46a, 0xbd1b, 0xc487, 0xcc70,
+ 0xce70, 0xd06e, 0xd26b, 0xd477, 0xdc75, 0xde89, 0xe474, 0xec73,
+ 0xf031, 0xf27a, 0xf479, 0xfc7f, 0x04e6, 0x0922, 0x0c63, 0x147b,
+ 0x187e, 0x1c84, 0x26ee, 0x2861, 0x2c60, 0x3061, 0x4081, 0x4882,
+ 0x50a8, 0x5888, 0x6083, 0x687d, 0x7086, 0x788b, 0x808a, 0x8885,
+ // Entry 80 - BF
+ 0x908d, 0x9892, 0x9c8f, 0xa139, 0xa890, 0xb08e, 0xb893, 0xc09e,
+ 0xc89a, 0xd096, 0xd89d, 0xe09c, 0xe897, 0xf098, 0xf89f, 0x004f,
+ 0x08a1, 0x10a3, 0x1caf, 0x20a2, 0x28a5, 0x30ab, 0x34ac, 0x3cad,
+ 0x42a6, 0x44b0, 0x461f, 0x4cb1, 0x54b6, 0x58b9, 0x5cb5, 0x64ba,
+ 0x6cb3, 0x70b7, 0x74b8, 0x7cc7, 0x84c0, 0x8ccf, 0x94d1, 0x9cce,
+ 0xa4c4, 0xaccc, 0xb4c9, 0xbcca, 0xc0cd, 0xc8d0, 0xd8bc, 0xe0c6,
+ 0xe4bd, 0xe6be, 0xe8cb, 0xf0bb, 0xf8d2, 0x00e2, 0x08d3, 0x10de,
+ 0x18dc, 0x20da, 0x2429, 0x265c, 0x2a30, 0x2d1c, 0x2e40, 0x30df,
+ // Entry C0 - FF
+ 0x38d4, 0x4940, 0x54e1, 0x5cd9, 0x64d5, 0x6cd7, 0x74e0, 0x7cd6,
+ 0x84db, 0x88c8, 0x8b34, 0x8e76, 0x90c1, 0x92f1, 0x94e9, 0x9ee3,
+ 0xace7, 0xb0f2, 0xb8e5, 0xc0e8, 0xc8ec, 0xd0ea, 0xd8ef, 0xe08c,
+ 0xe527, 0xeced, 0xf4f4, 0xfd03, 0x0505, 0x0707, 0x0d08, 0x183c,
+ 0x1d0f, 0x26aa, 0x2826, 0x2cb2, 0x2ebf, 0x34eb, 0x3d3a, 0x4514,
+ 0x4d19, 0x5509, 0x5d15, 0x6106, 0x650b, 0x6d13, 0x7d0e, 0x7f12,
+ 0x813f, 0x8310, 0x8516, 0x8d62, 0x9965, 0xa15e, 0xa86f, 0xb118,
+ 0xb30c, 0xb86d, 0xc10c, 0xc917, 0xd111, 0xd91e, 0xe10d, 0xe84e,
+ // Entry 100 - 13F
+ 0xf11d, 0xf525, 0xf924, 0x0123, 0x0926, 0x112a, 0x192d, 0x2023,
+ 0x2929, 0x312c, 0x3728, 0x3920, 0x3d2e, 0x4132, 0x4931, 0x4ec3,
+ 0x551a, 0x646c, 0x747c, 0x7e80, 0x80a0, 0x8299, 0x8530, 0x9136,
+ 0xa53e, 0xac37, 0xb537, 0xb938, 0xbd3c, 0xd941, 0xe543, 0xed5f,
+ 0xef5f, 0xf658, 0xfd63, 0x7c20, 0x7ef5, 0x80f6, 0x82f7, 0x84f8,
+ 0x86f9, 0x88fa, 0x8afb, 0x8cfc, 0x8e71, 0x90fe, 0x92ff, 0x9500,
+ 0x9701, 0x9902, 0x9b44, 0x9d45, 0x9f46, 0xa147, 0xa348, 0xa549,
+ 0xa74a, 0xa94b, 0xab4c, 0xad4d, 0xaf4e, 0xb14f, 0xb350, 0xb551,
+ // Entry 140 - 17F
+ 0xb752, 0xb953, 0xbb54, 0xbd55, 0xbf56, 0xc157, 0xc358, 0xc559,
+ 0xc75a, 0xc95b, 0xcb5c, 0xcd5d, 0xcf66,
+}
+
+// Size: 2128 bytes
+var variantIndex = map[string]uint8{
+ "1606nict": 0x0,
+ "1694acad": 0x1,
+ "1901": 0x2,
+ "1959acad": 0x3,
+ "1994": 0x67,
+ "1996": 0x4,
+ "abl1943": 0x5,
+ "akuapem": 0x6,
+ "alalc97": 0x69,
+ "aluku": 0x7,
+ "ao1990": 0x8,
+ "aranes": 0x9,
+ "arevela": 0xa,
+ "arevmda": 0xb,
+ "arkaika": 0xc,
+ "asante": 0xd,
+ "auvern": 0xe,
+ "baku1926": 0xf,
+ "balanka": 0x10,
+ "barla": 0x11,
+ "basiceng": 0x12,
+ "bauddha": 0x13,
+ "bciav": 0x14,
+ "bcizbl": 0x15,
+ "biscayan": 0x16,
+ "biske": 0x62,
+ "bohoric": 0x17,
+ "boont": 0x18,
+ "bornholm": 0x19,
+ "cisaup": 0x1a,
+ "colb1945": 0x1b,
+ "cornu": 0x1c,
+ "creiss": 0x1d,
+ "dajnko": 0x1e,
+ "ekavsk": 0x1f,
+ "emodeng": 0x20,
+ "fonipa": 0x6a,
+ "fonkirsh": 0x6b,
+ "fonnapa": 0x6c,
+ "fonupa": 0x6d,
+ "fonxsamp": 0x6e,
+ "gallo": 0x21,
+ "gascon": 0x22,
+ "grclass": 0x23,
+ "grital": 0x24,
+ "grmistr": 0x25,
+ "hepburn": 0x26,
+ "heploc": 0x68,
+ "hognorsk": 0x27,
+ "hsistemo": 0x28,
+ "ijekavsk": 0x29,
+ "itihasa": 0x2a,
+ "ivanchov": 0x2b,
+ "jauer": 0x2c,
+ "jyutping": 0x2d,
+ "kkcor": 0x2e,
+ "kociewie": 0x2f,
+ "kscor": 0x30,
+ "laukika": 0x31,
+ "lemosin": 0x32,
+ "lengadoc": 0x33,
+ "lipaw": 0x63,
+ "ltg1929": 0x34,
+ "ltg2007": 0x35,
+ "luna1918": 0x36,
+ "metelko": 0x37,
+ "monoton": 0x38,
+ "ndyuka": 0x39,
+ "nedis": 0x3a,
+ "newfound": 0x3b,
+ "nicard": 0x3c,
+ "njiva": 0x64,
+ "nulik": 0x3d,
+ "osojs": 0x65,
+ "oxendict": 0x3e,
+ "pahawh2": 0x3f,
+ "pahawh3": 0x40,
+ "pahawh4": 0x41,
+ "pamaka": 0x42,
+ "peano": 0x43,
+ "petr1708": 0x44,
+ "pinyin": 0x45,
+ "polyton": 0x46,
+ "provenc": 0x47,
+ "puter": 0x48,
+ "rigik": 0x49,
+ "rozaj": 0x4a,
+ "rumgr": 0x4b,
+ "scotland": 0x4c,
+ "scouse": 0x4d,
+ "simple": 0x6f,
+ "solba": 0x66,
+ "sotav": 0x4e,
+ "spanglis": 0x4f,
+ "surmiran": 0x50,
+ "sursilv": 0x51,
+ "sutsilv": 0x52,
+ "synnejyl": 0x53,
+ "tarask": 0x54,
+ "tongyong": 0x55,
+ "tunumiit": 0x56,
+ "uccor": 0x57,
+ "ucrcor": 0x58,
+ "ulster": 0x59,
+ "unifon": 0x5a,
+ "vaidika": 0x5b,
+ "valencia": 0x5c,
+ "vallader": 0x5d,
+ "vecdruka": 0x5e,
+ "vivaraup": 0x5f,
+ "wadegile": 0x60,
+ "xsistemo": 0x61,
+}
+
+// variantNumSpecialized is the number of specialized variants in variants.
+const variantNumSpecialized = 105
+
+// nRegionGroups is the number of region groups.
+const nRegionGroups = 33
+
+type likelyLangRegion struct {
+ lang uint16
+ region uint16
+}
+
+// likelyScript is a lookup table, indexed by scriptID, for the most likely
+// languages and regions given a script.
+// Size: 1052 bytes, 263 elements
+var likelyScript = [263]likelyLangRegion{
+ 1: {lang: 0x14e, region: 0x85},
+ 3: {lang: 0x2a2, region: 0x107},
+ 4: {lang: 0x1f, region: 0x9a},
+ 5: {lang: 0x3a, region: 0x6c},
+ 7: {lang: 0x3b, region: 0x9d},
+ 8: {lang: 0x1d7, region: 0x28},
+ 9: {lang: 0x13, region: 0x9d},
+ 10: {lang: 0x5b, region: 0x96},
+ 11: {lang: 0x60, region: 0x52},
+ 12: {lang: 0xb9, region: 0xb5},
+ 13: {lang: 0x63, region: 0x96},
+ 14: {lang: 0xa5, region: 0x35},
+ 15: {lang: 0x3e9, region: 0x9a},
+ 17: {lang: 0x529, region: 0x12f},
+ 18: {lang: 0x3b1, region: 0x9a},
+ 19: {lang: 0x15e, region: 0x79},
+ 20: {lang: 0xc2, region: 0x96},
+ 21: {lang: 0x9d, region: 0xe8},
+ 22: {lang: 0xdb, region: 0x35},
+ 23: {lang: 0xf3, region: 0x49},
+ 24: {lang: 0x4f0, region: 0x12c},
+ 25: {lang: 0xe7, region: 0x13f},
+ 26: {lang: 0xe5, region: 0x136},
+ 29: {lang: 0xf1, region: 0x6c},
+ 31: {lang: 0x1a0, region: 0x5e},
+ 32: {lang: 0x3e2, region: 0x107},
+ 34: {lang: 0x1be, region: 0x9a},
+ 38: {lang: 0x15e, region: 0x79},
+ 41: {lang: 0x133, region: 0x6c},
+ 42: {lang: 0x431, region: 0x27},
+ 44: {lang: 0x27, region: 0x70},
+ 46: {lang: 0x210, region: 0x7e},
+ 47: {lang: 0xfe, region: 0x38},
+ 49: {lang: 0x19b, region: 0x9a},
+ 50: {lang: 0x19e, region: 0x131},
+ 51: {lang: 0x3e9, region: 0x9a},
+ 52: {lang: 0x136, region: 0x88},
+ 53: {lang: 0x1a4, region: 0x9a},
+ 54: {lang: 0x39d, region: 0x9a},
+ 55: {lang: 0x529, region: 0x12f},
+ 56: {lang: 0x254, region: 0xac},
+ 57: {lang: 0x529, region: 0x53},
+ 58: {lang: 0x1cb, region: 0xe8},
+ 59: {lang: 0x529, region: 0x53},
+ 60: {lang: 0x529, region: 0x12f},
+ 61: {lang: 0x2fd, region: 0x9c},
+ 62: {lang: 0x1bc, region: 0x98},
+ 63: {lang: 0x200, region: 0xa3},
+ 64: {lang: 0x1c5, region: 0x12c},
+ 65: {lang: 0x1ca, region: 0xb0},
+ 68: {lang: 0x1d5, region: 0x93},
+ 70: {lang: 0x142, region: 0x9f},
+ 71: {lang: 0x254, region: 0xac},
+ 72: {lang: 0x20e, region: 0x96},
+ 73: {lang: 0x200, region: 0xa3},
+ 75: {lang: 0x135, region: 0xc5},
+ 76: {lang: 0x200, region: 0xa3},
+ 78: {lang: 0x3bb, region: 0xe9},
+ 79: {lang: 0x24a, region: 0xa7},
+ 80: {lang: 0x3fa, region: 0x9a},
+ 83: {lang: 0x251, region: 0x9a},
+ 84: {lang: 0x254, region: 0xac},
+ 86: {lang: 0x88, region: 0x9a},
+ 87: {lang: 0x370, region: 0x124},
+ 88: {lang: 0x2b8, region: 0xb0},
+ 93: {lang: 0x29f, region: 0x9a},
+ 94: {lang: 0x2a8, region: 0x9a},
+ 95: {lang: 0x28f, region: 0x88},
+ 96: {lang: 0x1a0, region: 0x88},
+ 97: {lang: 0x2ac, region: 0x53},
+ 99: {lang: 0x4f4, region: 0x12c},
+ 100: {lang: 0x4f5, region: 0x12c},
+ 101: {lang: 0x1be, region: 0x9a},
+ 103: {lang: 0x337, region: 0x9d},
+ 104: {lang: 0x4f7, region: 0x53},
+ 105: {lang: 0xa9, region: 0x53},
+ 108: {lang: 0x2e8, region: 0x113},
+ 109: {lang: 0x4f8, region: 0x10c},
+ 110: {lang: 0x4f8, region: 0x10c},
+ 111: {lang: 0x304, region: 0x9a},
+ 112: {lang: 0x31b, region: 0x9a},
+ 113: {lang: 0x30b, region: 0x53},
+ 115: {lang: 0x31e, region: 0x35},
+ 116: {lang: 0x30e, region: 0x9a},
+ 117: {lang: 0x414, region: 0xe9},
+ 118: {lang: 0x331, region: 0xc5},
+ 121: {lang: 0x4f9, region: 0x109},
+ 122: {lang: 0x3b, region: 0xa2},
+ 123: {lang: 0x353, region: 0xdc},
+ 126: {lang: 0x2d0, region: 0x85},
+ 127: {lang: 0x52a, region: 0x53},
+ 128: {lang: 0x403, region: 0x97},
+ 129: {lang: 0x3ee, region: 0x9a},
+ 130: {lang: 0x39b, region: 0xc6},
+ 131: {lang: 0x395, region: 0x9a},
+ 132: {lang: 0x399, region: 0x136},
+ 133: {lang: 0x429, region: 0x116},
+ 135: {lang: 0x3b, region: 0x11d},
+ 136: {lang: 0xfd, region: 0xc5},
+ 139: {lang: 0x27d, region: 0x107},
+ 140: {lang: 0x2c9, region: 0x53},
+ 141: {lang: 0x39f, region: 0x9d},
+ 142: {lang: 0x39f, region: 0x53},
+ 144: {lang: 0x3ad, region: 0xb1},
+ 146: {lang: 0x1c6, region: 0x53},
+ 147: {lang: 0x4fd, region: 0x9d},
+ 200: {lang: 0x3cb, region: 0x96},
+ 203: {lang: 0x372, region: 0x10d},
+ 204: {lang: 0x420, region: 0x98},
+ 206: {lang: 0x4ff, region: 0x15f},
+ 207: {lang: 0x3f0, region: 0x9a},
+ 208: {lang: 0x45, region: 0x136},
+ 209: {lang: 0x139, region: 0x7c},
+ 210: {lang: 0x3e9, region: 0x9a},
+ 212: {lang: 0x3e9, region: 0x9a},
+ 213: {lang: 0x3fa, region: 0x9a},
+ 214: {lang: 0x40c, region: 0xb4},
+ 217: {lang: 0x433, region: 0x9a},
+ 218: {lang: 0xef, region: 0xc6},
+ 219: {lang: 0x43e, region: 0x96},
+ 221: {lang: 0x44d, region: 0x35},
+ 222: {lang: 0x44e, region: 0x9c},
+ 226: {lang: 0x45a, region: 0xe8},
+ 227: {lang: 0x11a, region: 0x9a},
+ 228: {lang: 0x45e, region: 0x53},
+ 229: {lang: 0x232, region: 0x53},
+ 230: {lang: 0x450, region: 0x9a},
+ 231: {lang: 0x4a5, region: 0x53},
+ 232: {lang: 0x9f, region: 0x13f},
+ 233: {lang: 0x461, region: 0x9a},
+ 235: {lang: 0x528, region: 0xbb},
+ 236: {lang: 0x153, region: 0xe8},
+ 237: {lang: 0x128, region: 0xce},
+ 238: {lang: 0x46b, region: 0x124},
+ 239: {lang: 0xa9, region: 0x53},
+ 240: {lang: 0x2ce, region: 0x9a},
+ 243: {lang: 0x4ad, region: 0x11d},
+ 244: {lang: 0x4be, region: 0xb5},
+ 247: {lang: 0x1ce, region: 0x9a},
+ 250: {lang: 0x3a9, region: 0x9d},
+ 251: {lang: 0x22, region: 0x9c},
+ 253: {lang: 0x1ea, region: 0x53},
+ 254: {lang: 0xef, region: 0xc6},
+}
+
+type likelyScriptRegion struct {
+ region uint16
+ script uint16
+ flags uint8
+}
+
+// likelyLang is a lookup table, indexed by langID, for the most likely
+// scripts and regions given incomplete information. If more entries exist for a
+// given language, region and script are the index and size respectively
+// of the list in likelyLangList.
+// Size: 7980 bytes, 1330 elements
+var likelyLang = [1330]likelyScriptRegion{
+ 0: {region: 0x136, script: 0x5b, flags: 0x0},
+ 1: {region: 0x70, script: 0x5b, flags: 0x0},
+ 2: {region: 0x166, script: 0x5b, flags: 0x0},
+ 3: {region: 0x166, script: 0x5b, flags: 0x0},
+ 4: {region: 0x166, script: 0x5b, flags: 0x0},
+ 5: {region: 0x7e, script: 0x20, flags: 0x0},
+ 6: {region: 0x166, script: 0x5b, flags: 0x0},
+ 7: {region: 0x166, script: 0x20, flags: 0x0},
+ 8: {region: 0x81, script: 0x5b, flags: 0x0},
+ 9: {region: 0x166, script: 0x5b, flags: 0x0},
+ 10: {region: 0x166, script: 0x5b, flags: 0x0},
+ 11: {region: 0x166, script: 0x5b, flags: 0x0},
+ 12: {region: 0x96, script: 0x5b, flags: 0x0},
+ 13: {region: 0x132, script: 0x5b, flags: 0x0},
+ 14: {region: 0x81, script: 0x5b, flags: 0x0},
+ 15: {region: 0x166, script: 0x5b, flags: 0x0},
+ 16: {region: 0x166, script: 0x5b, flags: 0x0},
+ 17: {region: 0x107, script: 0x20, flags: 0x0},
+ 18: {region: 0x166, script: 0x5b, flags: 0x0},
+ 19: {region: 0x9d, script: 0x9, flags: 0x0},
+ 20: {region: 0x129, script: 0x5, flags: 0x0},
+ 21: {region: 0x166, script: 0x5b, flags: 0x0},
+ 22: {region: 0x162, script: 0x5b, flags: 0x0},
+ 23: {region: 0x166, script: 0x5b, flags: 0x0},
+ 24: {region: 0x166, script: 0x5b, flags: 0x0},
+ 25: {region: 0x166, script: 0x5b, flags: 0x0},
+ 26: {region: 0x166, script: 0x5b, flags: 0x0},
+ 27: {region: 0x166, script: 0x5b, flags: 0x0},
+ 28: {region: 0x52, script: 0x5b, flags: 0x0},
+ 29: {region: 0x166, script: 0x5b, flags: 0x0},
+ 30: {region: 0x166, script: 0x5b, flags: 0x0},
+ 31: {region: 0x9a, script: 0x4, flags: 0x0},
+ 32: {region: 0x166, script: 0x5b, flags: 0x0},
+ 33: {region: 0x81, script: 0x5b, flags: 0x0},
+ 34: {region: 0x9c, script: 0xfb, flags: 0x0},
+ 35: {region: 0x166, script: 0x5b, flags: 0x0},
+ 36: {region: 0x166, script: 0x5b, flags: 0x0},
+ 37: {region: 0x14e, script: 0x5b, flags: 0x0},
+ 38: {region: 0x107, script: 0x20, flags: 0x0},
+ 39: {region: 0x70, script: 0x2c, flags: 0x0},
+ 40: {region: 0x166, script: 0x5b, flags: 0x0},
+ 41: {region: 0x166, script: 0x5b, flags: 0x0},
+ 42: {region: 0xd7, script: 0x5b, flags: 0x0},
+ 43: {region: 0x166, script: 0x5b, flags: 0x0},
+ 45: {region: 0x166, script: 0x5b, flags: 0x0},
+ 46: {region: 0x166, script: 0x5b, flags: 0x0},
+ 47: {region: 0x166, script: 0x5b, flags: 0x0},
+ 48: {region: 0x166, script: 0x5b, flags: 0x0},
+ 49: {region: 0x166, script: 0x5b, flags: 0x0},
+ 50: {region: 0x166, script: 0x5b, flags: 0x0},
+ 51: {region: 0x96, script: 0x5b, flags: 0x0},
+ 52: {region: 0x166, script: 0x5, flags: 0x0},
+ 53: {region: 0x123, script: 0x5, flags: 0x0},
+ 54: {region: 0x166, script: 0x5b, flags: 0x0},
+ 55: {region: 0x166, script: 0x5b, flags: 0x0},
+ 56: {region: 0x166, script: 0x5b, flags: 0x0},
+ 57: {region: 0x166, script: 0x5b, flags: 0x0},
+ 58: {region: 0x6c, script: 0x5, flags: 0x0},
+ 59: {region: 0x0, script: 0x3, flags: 0x1},
+ 60: {region: 0x166, script: 0x5b, flags: 0x0},
+ 61: {region: 0x51, script: 0x5b, flags: 0x0},
+ 62: {region: 0x3f, script: 0x5b, flags: 0x0},
+ 63: {region: 0x68, script: 0x5, flags: 0x0},
+ 65: {region: 0xbb, script: 0x5, flags: 0x0},
+ 66: {region: 0x6c, script: 0x5, flags: 0x0},
+ 67: {region: 0x9a, script: 0xe, flags: 0x0},
+ 68: {region: 0x130, script: 0x5b, flags: 0x0},
+ 69: {region: 0x136, script: 0xd0, flags: 0x0},
+ 70: {region: 0x166, script: 0x5b, flags: 0x0},
+ 71: {region: 0x166, script: 0x5b, flags: 0x0},
+ 72: {region: 0x6f, script: 0x5b, flags: 0x0},
+ 73: {region: 0x166, script: 0x5b, flags: 0x0},
+ 74: {region: 0x166, script: 0x5b, flags: 0x0},
+ 75: {region: 0x49, script: 0x5b, flags: 0x0},
+ 76: {region: 0x166, script: 0x5b, flags: 0x0},
+ 77: {region: 0x107, script: 0x20, flags: 0x0},
+ 78: {region: 0x166, script: 0x5, flags: 0x0},
+ 79: {region: 0x166, script: 0x5b, flags: 0x0},
+ 80: {region: 0x166, script: 0x5b, flags: 0x0},
+ 81: {region: 0x166, script: 0x5b, flags: 0x0},
+ 82: {region: 0x9a, script: 0x22, flags: 0x0},
+ 83: {region: 0x166, script: 0x5b, flags: 0x0},
+ 84: {region: 0x166, script: 0x5b, flags: 0x0},
+ 85: {region: 0x166, script: 0x5b, flags: 0x0},
+ 86: {region: 0x3f, script: 0x5b, flags: 0x0},
+ 87: {region: 0x166, script: 0x5b, flags: 0x0},
+ 88: {region: 0x3, script: 0x5, flags: 0x1},
+ 89: {region: 0x107, script: 0x20, flags: 0x0},
+ 90: {region: 0xe9, script: 0x5, flags: 0x0},
+ 91: {region: 0x96, script: 0x5b, flags: 0x0},
+ 92: {region: 0xdc, script: 0x22, flags: 0x0},
+ 93: {region: 0x2e, script: 0x5b, flags: 0x0},
+ 94: {region: 0x52, script: 0x5b, flags: 0x0},
+ 95: {region: 0x166, script: 0x5b, flags: 0x0},
+ 96: {region: 0x52, script: 0xb, flags: 0x0},
+ 97: {region: 0x166, script: 0x5b, flags: 0x0},
+ 98: {region: 0x166, script: 0x5b, flags: 0x0},
+ 99: {region: 0x96, script: 0x5b, flags: 0x0},
+ 100: {region: 0x166, script: 0x5b, flags: 0x0},
+ 101: {region: 0x52, script: 0x5b, flags: 0x0},
+ 102: {region: 0x166, script: 0x5b, flags: 0x0},
+ 103: {region: 0x166, script: 0x5b, flags: 0x0},
+ 104: {region: 0x166, script: 0x5b, flags: 0x0},
+ 105: {region: 0x166, script: 0x5b, flags: 0x0},
+ 106: {region: 0x4f, script: 0x5b, flags: 0x0},
+ 107: {region: 0x166, script: 0x5b, flags: 0x0},
+ 108: {region: 0x166, script: 0x5b, flags: 0x0},
+ 109: {region: 0x166, script: 0x5b, flags: 0x0},
+ 110: {region: 0x166, script: 0x2c, flags: 0x0},
+ 111: {region: 0x166, script: 0x5b, flags: 0x0},
+ 112: {region: 0x166, script: 0x5b, flags: 0x0},
+ 113: {region: 0x47, script: 0x20, flags: 0x0},
+ 114: {region: 0x166, script: 0x5b, flags: 0x0},
+ 115: {region: 0x166, script: 0x5b, flags: 0x0},
+ 116: {region: 0x10c, script: 0x5, flags: 0x0},
+ 117: {region: 0x163, script: 0x5b, flags: 0x0},
+ 118: {region: 0x166, script: 0x5b, flags: 0x0},
+ 119: {region: 0x96, script: 0x5b, flags: 0x0},
+ 120: {region: 0x166, script: 0x5b, flags: 0x0},
+ 121: {region: 0x130, script: 0x5b, flags: 0x0},
+ 122: {region: 0x52, script: 0x5b, flags: 0x0},
+ 123: {region: 0x9a, script: 0xe6, flags: 0x0},
+ 124: {region: 0xe9, script: 0x5, flags: 0x0},
+ 125: {region: 0x9a, script: 0x22, flags: 0x0},
+ 126: {region: 0x38, script: 0x20, flags: 0x0},
+ 127: {region: 0x9a, script: 0x22, flags: 0x0},
+ 128: {region: 0xe9, script: 0x5, flags: 0x0},
+ 129: {region: 0x12c, script: 0x34, flags: 0x0},
+ 131: {region: 0x9a, script: 0x22, flags: 0x0},
+ 132: {region: 0x166, script: 0x5b, flags: 0x0},
+ 133: {region: 0x9a, script: 0x22, flags: 0x0},
+ 134: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 135: {region: 0x166, script: 0x5b, flags: 0x0},
+ 136: {region: 0x9a, script: 0x22, flags: 0x0},
+ 137: {region: 0x166, script: 0x5b, flags: 0x0},
+ 138: {region: 0x140, script: 0x5b, flags: 0x0},
+ 139: {region: 0x166, script: 0x5b, flags: 0x0},
+ 140: {region: 0x166, script: 0x5b, flags: 0x0},
+ 141: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 142: {region: 0x166, script: 0x5b, flags: 0x0},
+ 143: {region: 0xd7, script: 0x5b, flags: 0x0},
+ 144: {region: 0x166, script: 0x5b, flags: 0x0},
+ 145: {region: 0x166, script: 0x5b, flags: 0x0},
+ 146: {region: 0x166, script: 0x5b, flags: 0x0},
+ 147: {region: 0x166, script: 0x2c, flags: 0x0},
+ 148: {region: 0x9a, script: 0x22, flags: 0x0},
+ 149: {region: 0x96, script: 0x5b, flags: 0x0},
+ 150: {region: 0x166, script: 0x5b, flags: 0x0},
+ 151: {region: 0x166, script: 0x5b, flags: 0x0},
+ 152: {region: 0x115, script: 0x5b, flags: 0x0},
+ 153: {region: 0x166, script: 0x5b, flags: 0x0},
+ 154: {region: 0x166, script: 0x5b, flags: 0x0},
+ 155: {region: 0x52, script: 0x5b, flags: 0x0},
+ 156: {region: 0x166, script: 0x5b, flags: 0x0},
+ 157: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 158: {region: 0x166, script: 0x5b, flags: 0x0},
+ 159: {region: 0x13f, script: 0xe8, flags: 0x0},
+ 160: {region: 0xc4, script: 0x5b, flags: 0x0},
+ 161: {region: 0x166, script: 0x5b, flags: 0x0},
+ 162: {region: 0x166, script: 0x5b, flags: 0x0},
+ 163: {region: 0xc4, script: 0x5b, flags: 0x0},
+ 164: {region: 0x166, script: 0x5b, flags: 0x0},
+ 165: {region: 0x35, script: 0xe, flags: 0x0},
+ 166: {region: 0x166, script: 0x5b, flags: 0x0},
+ 167: {region: 0x166, script: 0x5b, flags: 0x0},
+ 168: {region: 0x166, script: 0x5b, flags: 0x0},
+ 169: {region: 0x53, script: 0xef, flags: 0x0},
+ 170: {region: 0x166, script: 0x5b, flags: 0x0},
+ 171: {region: 0x166, script: 0x5b, flags: 0x0},
+ 172: {region: 0x166, script: 0x5b, flags: 0x0},
+ 173: {region: 0x9a, script: 0xe, flags: 0x0},
+ 174: {region: 0x166, script: 0x5b, flags: 0x0},
+ 175: {region: 0x9d, script: 0x5, flags: 0x0},
+ 176: {region: 0x166, script: 0x5b, flags: 0x0},
+ 177: {region: 0x4f, script: 0x5b, flags: 0x0},
+ 178: {region: 0x79, script: 0x5b, flags: 0x0},
+ 179: {region: 0x9a, script: 0x22, flags: 0x0},
+ 180: {region: 0xe9, script: 0x5, flags: 0x0},
+ 181: {region: 0x9a, script: 0x22, flags: 0x0},
+ 182: {region: 0x166, script: 0x5b, flags: 0x0},
+ 183: {region: 0x33, script: 0x5b, flags: 0x0},
+ 184: {region: 0x166, script: 0x5b, flags: 0x0},
+ 185: {region: 0xb5, script: 0xc, flags: 0x0},
+ 186: {region: 0x52, script: 0x5b, flags: 0x0},
+ 187: {region: 0x166, script: 0x2c, flags: 0x0},
+ 188: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 189: {region: 0x166, script: 0x5b, flags: 0x0},
+ 190: {region: 0xe9, script: 0x22, flags: 0x0},
+ 191: {region: 0x107, script: 0x20, flags: 0x0},
+ 192: {region: 0x160, script: 0x5b, flags: 0x0},
+ 193: {region: 0x166, script: 0x5b, flags: 0x0},
+ 194: {region: 0x96, script: 0x5b, flags: 0x0},
+ 195: {region: 0x166, script: 0x5b, flags: 0x0},
+ 196: {region: 0x52, script: 0x5b, flags: 0x0},
+ 197: {region: 0x166, script: 0x5b, flags: 0x0},
+ 198: {region: 0x166, script: 0x5b, flags: 0x0},
+ 199: {region: 0x166, script: 0x5b, flags: 0x0},
+ 200: {region: 0x87, script: 0x5b, flags: 0x0},
+ 201: {region: 0x166, script: 0x5b, flags: 0x0},
+ 202: {region: 0x166, script: 0x5b, flags: 0x0},
+ 203: {region: 0x166, script: 0x5b, flags: 0x0},
+ 204: {region: 0x166, script: 0x5b, flags: 0x0},
+ 205: {region: 0x6e, script: 0x2c, flags: 0x0},
+ 206: {region: 0x166, script: 0x5b, flags: 0x0},
+ 207: {region: 0x166, script: 0x5b, flags: 0x0},
+ 208: {region: 0x52, script: 0x5b, flags: 0x0},
+ 209: {region: 0x166, script: 0x5b, flags: 0x0},
+ 210: {region: 0x166, script: 0x5b, flags: 0x0},
+ 211: {region: 0xc4, script: 0x5b, flags: 0x0},
+ 212: {region: 0x166, script: 0x5b, flags: 0x0},
+ 213: {region: 0x166, script: 0x5b, flags: 0x0},
+ 214: {region: 0x166, script: 0x5b, flags: 0x0},
+ 215: {region: 0x6f, script: 0x5b, flags: 0x0},
+ 216: {region: 0x166, script: 0x5b, flags: 0x0},
+ 217: {region: 0x166, script: 0x5b, flags: 0x0},
+ 218: {region: 0xd7, script: 0x5b, flags: 0x0},
+ 219: {region: 0x35, script: 0x16, flags: 0x0},
+ 220: {region: 0x107, script: 0x20, flags: 0x0},
+ 221: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 222: {region: 0x166, script: 0x5b, flags: 0x0},
+ 223: {region: 0x132, script: 0x5b, flags: 0x0},
+ 224: {region: 0x8b, script: 0x5b, flags: 0x0},
+ 225: {region: 0x76, script: 0x5b, flags: 0x0},
+ 226: {region: 0x107, script: 0x20, flags: 0x0},
+ 227: {region: 0x136, script: 0x5b, flags: 0x0},
+ 228: {region: 0x49, script: 0x5b, flags: 0x0},
+ 229: {region: 0x136, script: 0x1a, flags: 0x0},
+ 230: {region: 0xa7, script: 0x5, flags: 0x0},
+ 231: {region: 0x13f, script: 0x19, flags: 0x0},
+ 232: {region: 0x166, script: 0x5b, flags: 0x0},
+ 233: {region: 0x9c, script: 0x5, flags: 0x0},
+ 234: {region: 0x166, script: 0x5b, flags: 0x0},
+ 235: {region: 0x166, script: 0x5b, flags: 0x0},
+ 236: {region: 0x166, script: 0x5b, flags: 0x0},
+ 237: {region: 0x166, script: 0x5b, flags: 0x0},
+ 238: {region: 0x166, script: 0x5b, flags: 0x0},
+ 239: {region: 0xc6, script: 0xda, flags: 0x0},
+ 240: {region: 0x79, script: 0x5b, flags: 0x0},
+ 241: {region: 0x6c, script: 0x1d, flags: 0x0},
+ 242: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 243: {region: 0x49, script: 0x17, flags: 0x0},
+ 244: {region: 0x131, script: 0x20, flags: 0x0},
+ 245: {region: 0x49, script: 0x17, flags: 0x0},
+ 246: {region: 0x49, script: 0x17, flags: 0x0},
+ 247: {region: 0x49, script: 0x17, flags: 0x0},
+ 248: {region: 0x49, script: 0x17, flags: 0x0},
+ 249: {region: 0x10b, script: 0x5b, flags: 0x0},
+ 250: {region: 0x5f, script: 0x5b, flags: 0x0},
+ 251: {region: 0xea, script: 0x5b, flags: 0x0},
+ 252: {region: 0x49, script: 0x17, flags: 0x0},
+ 253: {region: 0xc5, script: 0x88, flags: 0x0},
+ 254: {region: 0x8, script: 0x2, flags: 0x1},
+ 255: {region: 0x107, script: 0x20, flags: 0x0},
+ 256: {region: 0x7c, script: 0x5b, flags: 0x0},
+ 257: {region: 0x64, script: 0x5b, flags: 0x0},
+ 258: {region: 0x166, script: 0x5b, flags: 0x0},
+ 259: {region: 0x166, script: 0x5b, flags: 0x0},
+ 260: {region: 0x166, script: 0x5b, flags: 0x0},
+ 261: {region: 0x166, script: 0x5b, flags: 0x0},
+ 262: {region: 0x136, script: 0x5b, flags: 0x0},
+ 263: {region: 0x107, script: 0x20, flags: 0x0},
+ 264: {region: 0xa5, script: 0x5b, flags: 0x0},
+ 265: {region: 0x166, script: 0x5b, flags: 0x0},
+ 266: {region: 0x166, script: 0x5b, flags: 0x0},
+ 267: {region: 0x9a, script: 0x5, flags: 0x0},
+ 268: {region: 0x166, script: 0x5b, flags: 0x0},
+ 269: {region: 0x61, script: 0x5b, flags: 0x0},
+ 270: {region: 0x166, script: 0x5b, flags: 0x0},
+ 271: {region: 0x49, script: 0x5b, flags: 0x0},
+ 272: {region: 0x166, script: 0x5b, flags: 0x0},
+ 273: {region: 0x166, script: 0x5b, flags: 0x0},
+ 274: {region: 0x166, script: 0x5b, flags: 0x0},
+ 275: {region: 0x166, script: 0x5, flags: 0x0},
+ 276: {region: 0x49, script: 0x5b, flags: 0x0},
+ 277: {region: 0x166, script: 0x5b, flags: 0x0},
+ 278: {region: 0x166, script: 0x5b, flags: 0x0},
+ 279: {region: 0xd5, script: 0x5b, flags: 0x0},
+ 280: {region: 0x4f, script: 0x5b, flags: 0x0},
+ 281: {region: 0x166, script: 0x5b, flags: 0x0},
+ 282: {region: 0x9a, script: 0x5, flags: 0x0},
+ 283: {region: 0x166, script: 0x5b, flags: 0x0},
+ 284: {region: 0x166, script: 0x5b, flags: 0x0},
+ 285: {region: 0x166, script: 0x5b, flags: 0x0},
+ 286: {region: 0x166, script: 0x2c, flags: 0x0},
+ 287: {region: 0x61, script: 0x5b, flags: 0x0},
+ 288: {region: 0xc4, script: 0x5b, flags: 0x0},
+ 289: {region: 0xd1, script: 0x5b, flags: 0x0},
+ 290: {region: 0x166, script: 0x5b, flags: 0x0},
+ 291: {region: 0xdc, script: 0x22, flags: 0x0},
+ 292: {region: 0x52, script: 0x5b, flags: 0x0},
+ 293: {region: 0x166, script: 0x5b, flags: 0x0},
+ 294: {region: 0x166, script: 0x5b, flags: 0x0},
+ 295: {region: 0x166, script: 0x5b, flags: 0x0},
+ 296: {region: 0xce, script: 0xed, flags: 0x0},
+ 297: {region: 0x166, script: 0x5b, flags: 0x0},
+ 298: {region: 0x166, script: 0x5b, flags: 0x0},
+ 299: {region: 0x115, script: 0x5b, flags: 0x0},
+ 300: {region: 0x37, script: 0x5b, flags: 0x0},
+ 301: {region: 0x43, script: 0xef, flags: 0x0},
+ 302: {region: 0x166, script: 0x5b, flags: 0x0},
+ 303: {region: 0xa5, script: 0x5b, flags: 0x0},
+ 304: {region: 0x81, script: 0x5b, flags: 0x0},
+ 305: {region: 0xd7, script: 0x5b, flags: 0x0},
+ 306: {region: 0x9f, script: 0x5b, flags: 0x0},
+ 307: {region: 0x6c, script: 0x29, flags: 0x0},
+ 308: {region: 0x166, script: 0x5b, flags: 0x0},
+ 309: {region: 0xc5, script: 0x4b, flags: 0x0},
+ 310: {region: 0x88, script: 0x34, flags: 0x0},
+ 311: {region: 0x166, script: 0x5b, flags: 0x0},
+ 312: {region: 0x166, script: 0x5b, flags: 0x0},
+ 313: {region: 0xa, script: 0x2, flags: 0x1},
+ 314: {region: 0x166, script: 0x5b, flags: 0x0},
+ 315: {region: 0x166, script: 0x5b, flags: 0x0},
+ 316: {region: 0x1, script: 0x5b, flags: 0x0},
+ 317: {region: 0x166, script: 0x5b, flags: 0x0},
+ 318: {region: 0x6f, script: 0x5b, flags: 0x0},
+ 319: {region: 0x136, script: 0x5b, flags: 0x0},
+ 320: {region: 0x6b, script: 0x5b, flags: 0x0},
+ 321: {region: 0x166, script: 0x5b, flags: 0x0},
+ 322: {region: 0x9f, script: 0x46, flags: 0x0},
+ 323: {region: 0x166, script: 0x5b, flags: 0x0},
+ 324: {region: 0x166, script: 0x5b, flags: 0x0},
+ 325: {region: 0x6f, script: 0x5b, flags: 0x0},
+ 326: {region: 0x52, script: 0x5b, flags: 0x0},
+ 327: {region: 0x6f, script: 0x5b, flags: 0x0},
+ 328: {region: 0x9d, script: 0x5, flags: 0x0},
+ 329: {region: 0x166, script: 0x5b, flags: 0x0},
+ 330: {region: 0x166, script: 0x5b, flags: 0x0},
+ 331: {region: 0x166, script: 0x5b, flags: 0x0},
+ 332: {region: 0x166, script: 0x5b, flags: 0x0},
+ 333: {region: 0x87, script: 0x5b, flags: 0x0},
+ 334: {region: 0xc, script: 0x2, flags: 0x1},
+ 335: {region: 0x166, script: 0x5b, flags: 0x0},
+ 336: {region: 0xc4, script: 0x5b, flags: 0x0},
+ 337: {region: 0x73, script: 0x5b, flags: 0x0},
+ 338: {region: 0x10c, script: 0x5, flags: 0x0},
+ 339: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 340: {region: 0x10d, script: 0x5b, flags: 0x0},
+ 341: {region: 0x74, script: 0x5b, flags: 0x0},
+ 342: {region: 0x166, script: 0x5b, flags: 0x0},
+ 343: {region: 0x166, script: 0x5b, flags: 0x0},
+ 344: {region: 0x77, script: 0x5b, flags: 0x0},
+ 345: {region: 0x166, script: 0x5b, flags: 0x0},
+ 346: {region: 0x3b, script: 0x5b, flags: 0x0},
+ 347: {region: 0x166, script: 0x5b, flags: 0x0},
+ 348: {region: 0x166, script: 0x5b, flags: 0x0},
+ 349: {region: 0x166, script: 0x5b, flags: 0x0},
+ 350: {region: 0x79, script: 0x5b, flags: 0x0},
+ 351: {region: 0x136, script: 0x5b, flags: 0x0},
+ 352: {region: 0x79, script: 0x5b, flags: 0x0},
+ 353: {region: 0x61, script: 0x5b, flags: 0x0},
+ 354: {region: 0x61, script: 0x5b, flags: 0x0},
+ 355: {region: 0x52, script: 0x5, flags: 0x0},
+ 356: {region: 0x141, script: 0x5b, flags: 0x0},
+ 357: {region: 0x166, script: 0x5b, flags: 0x0},
+ 358: {region: 0x85, script: 0x5b, flags: 0x0},
+ 359: {region: 0x166, script: 0x5b, flags: 0x0},
+ 360: {region: 0xd5, script: 0x5b, flags: 0x0},
+ 361: {region: 0x9f, script: 0x5b, flags: 0x0},
+ 362: {region: 0xd7, script: 0x5b, flags: 0x0},
+ 363: {region: 0x166, script: 0x5b, flags: 0x0},
+ 364: {region: 0x10c, script: 0x5b, flags: 0x0},
+ 365: {region: 0xda, script: 0x5b, flags: 0x0},
+ 366: {region: 0x97, script: 0x5b, flags: 0x0},
+ 367: {region: 0x81, script: 0x5b, flags: 0x0},
+ 368: {region: 0x166, script: 0x5b, flags: 0x0},
+ 369: {region: 0xbd, script: 0x5b, flags: 0x0},
+ 370: {region: 0x166, script: 0x5b, flags: 0x0},
+ 371: {region: 0x166, script: 0x5b, flags: 0x0},
+ 372: {region: 0x166, script: 0x5b, flags: 0x0},
+ 373: {region: 0x53, script: 0x3b, flags: 0x0},
+ 374: {region: 0x166, script: 0x5b, flags: 0x0},
+ 375: {region: 0x96, script: 0x5b, flags: 0x0},
+ 376: {region: 0x166, script: 0x5b, flags: 0x0},
+ 377: {region: 0x166, script: 0x5b, flags: 0x0},
+ 378: {region: 0x9a, script: 0x22, flags: 0x0},
+ 379: {region: 0x166, script: 0x5b, flags: 0x0},
+ 380: {region: 0x9d, script: 0x5, flags: 0x0},
+ 381: {region: 0x7f, script: 0x5b, flags: 0x0},
+ 382: {region: 0x7c, script: 0x5b, flags: 0x0},
+ 383: {region: 0x166, script: 0x5b, flags: 0x0},
+ 384: {region: 0x166, script: 0x5b, flags: 0x0},
+ 385: {region: 0x166, script: 0x5b, flags: 0x0},
+ 386: {region: 0x166, script: 0x5b, flags: 0x0},
+ 387: {region: 0x166, script: 0x5b, flags: 0x0},
+ 388: {region: 0x166, script: 0x5b, flags: 0x0},
+ 389: {region: 0x70, script: 0x2c, flags: 0x0},
+ 390: {region: 0x166, script: 0x5b, flags: 0x0},
+ 391: {region: 0xdc, script: 0x22, flags: 0x0},
+ 392: {region: 0x166, script: 0x5b, flags: 0x0},
+ 393: {region: 0xa8, script: 0x5b, flags: 0x0},
+ 394: {region: 0x166, script: 0x5b, flags: 0x0},
+ 395: {region: 0xe9, script: 0x5, flags: 0x0},
+ 396: {region: 0x166, script: 0x5b, flags: 0x0},
+ 397: {region: 0xe9, script: 0x5, flags: 0x0},
+ 398: {region: 0x166, script: 0x5b, flags: 0x0},
+ 399: {region: 0x166, script: 0x5b, flags: 0x0},
+ 400: {region: 0x6f, script: 0x5b, flags: 0x0},
+ 401: {region: 0x9d, script: 0x5, flags: 0x0},
+ 402: {region: 0x166, script: 0x5b, flags: 0x0},
+ 403: {region: 0x166, script: 0x2c, flags: 0x0},
+ 404: {region: 0xf2, script: 0x5b, flags: 0x0},
+ 405: {region: 0x166, script: 0x5b, flags: 0x0},
+ 406: {region: 0x166, script: 0x5b, flags: 0x0},
+ 407: {region: 0x166, script: 0x5b, flags: 0x0},
+ 408: {region: 0x166, script: 0x2c, flags: 0x0},
+ 409: {region: 0x166, script: 0x5b, flags: 0x0},
+ 410: {region: 0x9a, script: 0x22, flags: 0x0},
+ 411: {region: 0x9a, script: 0xe9, flags: 0x0},
+ 412: {region: 0x96, script: 0x5b, flags: 0x0},
+ 413: {region: 0xda, script: 0x5b, flags: 0x0},
+ 414: {region: 0x131, script: 0x32, flags: 0x0},
+ 415: {region: 0x166, script: 0x5b, flags: 0x0},
+ 416: {region: 0xe, script: 0x2, flags: 0x1},
+ 417: {region: 0x9a, script: 0xe, flags: 0x0},
+ 418: {region: 0x166, script: 0x5b, flags: 0x0},
+ 419: {region: 0x4e, script: 0x5b, flags: 0x0},
+ 420: {region: 0x9a, script: 0x35, flags: 0x0},
+ 421: {region: 0x41, script: 0x5b, flags: 0x0},
+ 422: {region: 0x54, script: 0x5b, flags: 0x0},
+ 423: {region: 0x166, script: 0x5b, flags: 0x0},
+ 424: {region: 0x81, script: 0x5b, flags: 0x0},
+ 425: {region: 0x166, script: 0x5b, flags: 0x0},
+ 426: {region: 0x166, script: 0x5b, flags: 0x0},
+ 427: {region: 0xa5, script: 0x5b, flags: 0x0},
+ 428: {region: 0x99, script: 0x5b, flags: 0x0},
+ 429: {region: 0x166, script: 0x5b, flags: 0x0},
+ 430: {region: 0xdc, script: 0x22, flags: 0x0},
+ 431: {region: 0x166, script: 0x5b, flags: 0x0},
+ 432: {region: 0x166, script: 0x5, flags: 0x0},
+ 433: {region: 0x49, script: 0x5b, flags: 0x0},
+ 434: {region: 0x166, script: 0x5, flags: 0x0},
+ 435: {region: 0x166, script: 0x5b, flags: 0x0},
+ 436: {region: 0x10, script: 0x3, flags: 0x1},
+ 437: {region: 0x166, script: 0x5b, flags: 0x0},
+ 438: {region: 0x53, script: 0x3b, flags: 0x0},
+ 439: {region: 0x166, script: 0x5b, flags: 0x0},
+ 440: {region: 0x136, script: 0x5b, flags: 0x0},
+ 441: {region: 0x24, script: 0x5, flags: 0x0},
+ 442: {region: 0x166, script: 0x5b, flags: 0x0},
+ 443: {region: 0x166, script: 0x2c, flags: 0x0},
+ 444: {region: 0x98, script: 0x3e, flags: 0x0},
+ 445: {region: 0x166, script: 0x5b, flags: 0x0},
+ 446: {region: 0x9a, script: 0x22, flags: 0x0},
+ 447: {region: 0x166, script: 0x5b, flags: 0x0},
+ 448: {region: 0x74, script: 0x5b, flags: 0x0},
+ 449: {region: 0x166, script: 0x5b, flags: 0x0},
+ 450: {region: 0x166, script: 0x5b, flags: 0x0},
+ 451: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 452: {region: 0x166, script: 0x5b, flags: 0x0},
+ 453: {region: 0x12c, script: 0x40, flags: 0x0},
+ 454: {region: 0x53, script: 0x92, flags: 0x0},
+ 455: {region: 0x166, script: 0x5b, flags: 0x0},
+ 456: {region: 0xe9, script: 0x5, flags: 0x0},
+ 457: {region: 0x9a, script: 0x22, flags: 0x0},
+ 458: {region: 0xb0, script: 0x41, flags: 0x0},
+ 459: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 460: {region: 0xe9, script: 0x5, flags: 0x0},
+ 461: {region: 0xe7, script: 0x5b, flags: 0x0},
+ 462: {region: 0x9a, script: 0x22, flags: 0x0},
+ 463: {region: 0x9a, script: 0x22, flags: 0x0},
+ 464: {region: 0x166, script: 0x5b, flags: 0x0},
+ 465: {region: 0x91, script: 0x5b, flags: 0x0},
+ 466: {region: 0x61, script: 0x5b, flags: 0x0},
+ 467: {region: 0x53, script: 0x3b, flags: 0x0},
+ 468: {region: 0x92, script: 0x5b, flags: 0x0},
+ 469: {region: 0x93, script: 0x5b, flags: 0x0},
+ 470: {region: 0x166, script: 0x5b, flags: 0x0},
+ 471: {region: 0x28, script: 0x8, flags: 0x0},
+ 472: {region: 0xd3, script: 0x5b, flags: 0x0},
+ 473: {region: 0x79, script: 0x5b, flags: 0x0},
+ 474: {region: 0x166, script: 0x5b, flags: 0x0},
+ 475: {region: 0x166, script: 0x5b, flags: 0x0},
+ 476: {region: 0xd1, script: 0x5b, flags: 0x0},
+ 477: {region: 0xd7, script: 0x5b, flags: 0x0},
+ 478: {region: 0x166, script: 0x5b, flags: 0x0},
+ 479: {region: 0x166, script: 0x5b, flags: 0x0},
+ 480: {region: 0x166, script: 0x5b, flags: 0x0},
+ 481: {region: 0x96, script: 0x5b, flags: 0x0},
+ 482: {region: 0x166, script: 0x5b, flags: 0x0},
+ 483: {region: 0x166, script: 0x5b, flags: 0x0},
+ 484: {region: 0x166, script: 0x5b, flags: 0x0},
+ 486: {region: 0x123, script: 0x5b, flags: 0x0},
+ 487: {region: 0xd7, script: 0x5b, flags: 0x0},
+ 488: {region: 0x166, script: 0x5b, flags: 0x0},
+ 489: {region: 0x166, script: 0x5b, flags: 0x0},
+ 490: {region: 0x53, script: 0xfd, flags: 0x0},
+ 491: {region: 0x166, script: 0x5b, flags: 0x0},
+ 492: {region: 0x136, script: 0x5b, flags: 0x0},
+ 493: {region: 0x166, script: 0x5b, flags: 0x0},
+ 494: {region: 0x49, script: 0x5b, flags: 0x0},
+ 495: {region: 0x166, script: 0x5b, flags: 0x0},
+ 496: {region: 0x166, script: 0x5b, flags: 0x0},
+ 497: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 498: {region: 0x166, script: 0x5b, flags: 0x0},
+ 499: {region: 0x96, script: 0x5b, flags: 0x0},
+ 500: {region: 0x107, script: 0x20, flags: 0x0},
+ 501: {region: 0x1, script: 0x5b, flags: 0x0},
+ 502: {region: 0x166, script: 0x5b, flags: 0x0},
+ 503: {region: 0x166, script: 0x5b, flags: 0x0},
+ 504: {region: 0x9e, script: 0x5b, flags: 0x0},
+ 505: {region: 0x9f, script: 0x5b, flags: 0x0},
+ 506: {region: 0x49, script: 0x17, flags: 0x0},
+ 507: {region: 0x98, script: 0x3e, flags: 0x0},
+ 508: {region: 0x166, script: 0x5b, flags: 0x0},
+ 509: {region: 0x166, script: 0x5b, flags: 0x0},
+ 510: {region: 0x107, script: 0x5b, flags: 0x0},
+ 511: {region: 0x166, script: 0x5b, flags: 0x0},
+ 512: {region: 0xa3, script: 0x49, flags: 0x0},
+ 513: {region: 0x166, script: 0x5b, flags: 0x0},
+ 514: {region: 0xa1, script: 0x5b, flags: 0x0},
+ 515: {region: 0x1, script: 0x5b, flags: 0x0},
+ 516: {region: 0x166, script: 0x5b, flags: 0x0},
+ 517: {region: 0x166, script: 0x5b, flags: 0x0},
+ 518: {region: 0x166, script: 0x5b, flags: 0x0},
+ 519: {region: 0x52, script: 0x5b, flags: 0x0},
+ 520: {region: 0x131, script: 0x3e, flags: 0x0},
+ 521: {region: 0x166, script: 0x5b, flags: 0x0},
+ 522: {region: 0x130, script: 0x5b, flags: 0x0},
+ 523: {region: 0xdc, script: 0x22, flags: 0x0},
+ 524: {region: 0x166, script: 0x5b, flags: 0x0},
+ 525: {region: 0x64, script: 0x5b, flags: 0x0},
+ 526: {region: 0x96, script: 0x5b, flags: 0x0},
+ 527: {region: 0x96, script: 0x5b, flags: 0x0},
+ 528: {region: 0x7e, script: 0x2e, flags: 0x0},
+ 529: {region: 0x138, script: 0x20, flags: 0x0},
+ 530: {region: 0x68, script: 0x5b, flags: 0x0},
+ 531: {region: 0xc5, script: 0x5b, flags: 0x0},
+ 532: {region: 0x166, script: 0x5b, flags: 0x0},
+ 533: {region: 0x166, script: 0x5b, flags: 0x0},
+ 534: {region: 0xd7, script: 0x5b, flags: 0x0},
+ 535: {region: 0xa5, script: 0x5b, flags: 0x0},
+ 536: {region: 0xc4, script: 0x5b, flags: 0x0},
+ 537: {region: 0x107, script: 0x20, flags: 0x0},
+ 538: {region: 0x166, script: 0x5b, flags: 0x0},
+ 539: {region: 0x166, script: 0x5b, flags: 0x0},
+ 540: {region: 0x166, script: 0x5b, flags: 0x0},
+ 541: {region: 0x166, script: 0x5b, flags: 0x0},
+ 542: {region: 0xd5, script: 0x5, flags: 0x0},
+ 543: {region: 0xd7, script: 0x5b, flags: 0x0},
+ 544: {region: 0x165, script: 0x5b, flags: 0x0},
+ 545: {region: 0x166, script: 0x5b, flags: 0x0},
+ 546: {region: 0x166, script: 0x5b, flags: 0x0},
+ 547: {region: 0x130, script: 0x5b, flags: 0x0},
+ 548: {region: 0x123, script: 0x5, flags: 0x0},
+ 549: {region: 0x166, script: 0x5b, flags: 0x0},
+ 550: {region: 0x124, script: 0xee, flags: 0x0},
+ 551: {region: 0x5b, script: 0x5b, flags: 0x0},
+ 552: {region: 0x52, script: 0x5b, flags: 0x0},
+ 553: {region: 0x166, script: 0x5b, flags: 0x0},
+ 554: {region: 0x4f, script: 0x5b, flags: 0x0},
+ 555: {region: 0x9a, script: 0x22, flags: 0x0},
+ 556: {region: 0x9a, script: 0x22, flags: 0x0},
+ 557: {region: 0x4b, script: 0x5b, flags: 0x0},
+ 558: {region: 0x96, script: 0x5b, flags: 0x0},
+ 559: {region: 0x166, script: 0x5b, flags: 0x0},
+ 560: {region: 0x41, script: 0x5b, flags: 0x0},
+ 561: {region: 0x9a, script: 0x5b, flags: 0x0},
+ 562: {region: 0x53, script: 0xe5, flags: 0x0},
+ 563: {region: 0x9a, script: 0x22, flags: 0x0},
+ 564: {region: 0xc4, script: 0x5b, flags: 0x0},
+ 565: {region: 0x166, script: 0x5b, flags: 0x0},
+ 566: {region: 0x9a, script: 0x76, flags: 0x0},
+ 567: {region: 0xe9, script: 0x5, flags: 0x0},
+ 568: {region: 0x166, script: 0x5b, flags: 0x0},
+ 569: {region: 0xa5, script: 0x5b, flags: 0x0},
+ 570: {region: 0x166, script: 0x5b, flags: 0x0},
+ 571: {region: 0x12c, script: 0x5b, flags: 0x0},
+ 572: {region: 0x166, script: 0x5b, flags: 0x0},
+ 573: {region: 0xd3, script: 0x5b, flags: 0x0},
+ 574: {region: 0x166, script: 0x5b, flags: 0x0},
+ 575: {region: 0xb0, script: 0x58, flags: 0x0},
+ 576: {region: 0x166, script: 0x5b, flags: 0x0},
+ 577: {region: 0x166, script: 0x5b, flags: 0x0},
+ 578: {region: 0x13, script: 0x6, flags: 0x1},
+ 579: {region: 0x166, script: 0x5b, flags: 0x0},
+ 580: {region: 0x52, script: 0x5b, flags: 0x0},
+ 581: {region: 0x83, script: 0x5b, flags: 0x0},
+ 582: {region: 0xa5, script: 0x5b, flags: 0x0},
+ 583: {region: 0x166, script: 0x5b, flags: 0x0},
+ 584: {region: 0x166, script: 0x5b, flags: 0x0},
+ 585: {region: 0x166, script: 0x5b, flags: 0x0},
+ 586: {region: 0xa7, script: 0x4f, flags: 0x0},
+ 587: {region: 0x2a, script: 0x5b, flags: 0x0},
+ 588: {region: 0x166, script: 0x5b, flags: 0x0},
+ 589: {region: 0x166, script: 0x5b, flags: 0x0},
+ 590: {region: 0x166, script: 0x5b, flags: 0x0},
+ 591: {region: 0x166, script: 0x5b, flags: 0x0},
+ 592: {region: 0x166, script: 0x5b, flags: 0x0},
+ 593: {region: 0x9a, script: 0x53, flags: 0x0},
+ 594: {region: 0x8c, script: 0x5b, flags: 0x0},
+ 595: {region: 0x166, script: 0x5b, flags: 0x0},
+ 596: {region: 0xac, script: 0x54, flags: 0x0},
+ 597: {region: 0x107, script: 0x20, flags: 0x0},
+ 598: {region: 0x9a, script: 0x22, flags: 0x0},
+ 599: {region: 0x166, script: 0x5b, flags: 0x0},
+ 600: {region: 0x76, script: 0x5b, flags: 0x0},
+ 601: {region: 0x166, script: 0x5b, flags: 0x0},
+ 602: {region: 0xb5, script: 0x5b, flags: 0x0},
+ 603: {region: 0x166, script: 0x5b, flags: 0x0},
+ 604: {region: 0x166, script: 0x5b, flags: 0x0},
+ 605: {region: 0x166, script: 0x5b, flags: 0x0},
+ 606: {region: 0x166, script: 0x5b, flags: 0x0},
+ 607: {region: 0x166, script: 0x5b, flags: 0x0},
+ 608: {region: 0x166, script: 0x5b, flags: 0x0},
+ 609: {region: 0x166, script: 0x5b, flags: 0x0},
+ 610: {region: 0x166, script: 0x2c, flags: 0x0},
+ 611: {region: 0x166, script: 0x5b, flags: 0x0},
+ 612: {region: 0x107, script: 0x20, flags: 0x0},
+ 613: {region: 0x113, script: 0x5b, flags: 0x0},
+ 614: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 615: {region: 0x107, script: 0x5b, flags: 0x0},
+ 616: {region: 0x166, script: 0x5b, flags: 0x0},
+ 617: {region: 0x9a, script: 0x22, flags: 0x0},
+ 618: {region: 0x9a, script: 0x5, flags: 0x0},
+ 619: {region: 0x130, script: 0x5b, flags: 0x0},
+ 620: {region: 0x166, script: 0x5b, flags: 0x0},
+ 621: {region: 0x52, script: 0x5b, flags: 0x0},
+ 622: {region: 0x61, script: 0x5b, flags: 0x0},
+ 623: {region: 0x166, script: 0x5b, flags: 0x0},
+ 624: {region: 0x166, script: 0x5b, flags: 0x0},
+ 625: {region: 0x166, script: 0x2c, flags: 0x0},
+ 626: {region: 0x166, script: 0x5b, flags: 0x0},
+ 627: {region: 0x166, script: 0x5b, flags: 0x0},
+ 628: {region: 0x19, script: 0x3, flags: 0x1},
+ 629: {region: 0x166, script: 0x5b, flags: 0x0},
+ 630: {region: 0x166, script: 0x5b, flags: 0x0},
+ 631: {region: 0x166, script: 0x5b, flags: 0x0},
+ 632: {region: 0x166, script: 0x5b, flags: 0x0},
+ 633: {region: 0x107, script: 0x20, flags: 0x0},
+ 634: {region: 0x166, script: 0x5b, flags: 0x0},
+ 635: {region: 0x166, script: 0x5b, flags: 0x0},
+ 636: {region: 0x166, script: 0x5b, flags: 0x0},
+ 637: {region: 0x107, script: 0x20, flags: 0x0},
+ 638: {region: 0x166, script: 0x5b, flags: 0x0},
+ 639: {region: 0x96, script: 0x5b, flags: 0x0},
+ 640: {region: 0xe9, script: 0x5, flags: 0x0},
+ 641: {region: 0x7c, script: 0x5b, flags: 0x0},
+ 642: {region: 0x166, script: 0x5b, flags: 0x0},
+ 643: {region: 0x166, script: 0x5b, flags: 0x0},
+ 644: {region: 0x166, script: 0x5b, flags: 0x0},
+ 645: {region: 0x166, script: 0x2c, flags: 0x0},
+ 646: {region: 0x124, script: 0xee, flags: 0x0},
+ 647: {region: 0xe9, script: 0x5, flags: 0x0},
+ 648: {region: 0x166, script: 0x5b, flags: 0x0},
+ 649: {region: 0x166, script: 0x5b, flags: 0x0},
+ 650: {region: 0x1c, script: 0x5, flags: 0x1},
+ 651: {region: 0x166, script: 0x5b, flags: 0x0},
+ 652: {region: 0x166, script: 0x5b, flags: 0x0},
+ 653: {region: 0x166, script: 0x5b, flags: 0x0},
+ 654: {region: 0x139, script: 0x5b, flags: 0x0},
+ 655: {region: 0x88, script: 0x5f, flags: 0x0},
+ 656: {region: 0x98, script: 0x3e, flags: 0x0},
+ 657: {region: 0x130, script: 0x5b, flags: 0x0},
+ 658: {region: 0xe9, script: 0x5, flags: 0x0},
+ 659: {region: 0x132, script: 0x5b, flags: 0x0},
+ 660: {region: 0x166, script: 0x5b, flags: 0x0},
+ 661: {region: 0xb8, script: 0x5b, flags: 0x0},
+ 662: {region: 0x107, script: 0x20, flags: 0x0},
+ 663: {region: 0x166, script: 0x5b, flags: 0x0},
+ 664: {region: 0x96, script: 0x5b, flags: 0x0},
+ 665: {region: 0x166, script: 0x5b, flags: 0x0},
+ 666: {region: 0x53, script: 0xee, flags: 0x0},
+ 667: {region: 0x166, script: 0x5b, flags: 0x0},
+ 668: {region: 0x166, script: 0x5b, flags: 0x0},
+ 669: {region: 0x166, script: 0x5b, flags: 0x0},
+ 670: {region: 0x166, script: 0x5b, flags: 0x0},
+ 671: {region: 0x9a, script: 0x5d, flags: 0x0},
+ 672: {region: 0x166, script: 0x5b, flags: 0x0},
+ 673: {region: 0x166, script: 0x5b, flags: 0x0},
+ 674: {region: 0x107, script: 0x20, flags: 0x0},
+ 675: {region: 0x132, script: 0x5b, flags: 0x0},
+ 676: {region: 0x166, script: 0x5b, flags: 0x0},
+ 677: {region: 0xda, script: 0x5b, flags: 0x0},
+ 678: {region: 0x166, script: 0x5b, flags: 0x0},
+ 679: {region: 0x166, script: 0x5b, flags: 0x0},
+ 680: {region: 0x21, script: 0x2, flags: 0x1},
+ 681: {region: 0x166, script: 0x5b, flags: 0x0},
+ 682: {region: 0x166, script: 0x5b, flags: 0x0},
+ 683: {region: 0x9f, script: 0x5b, flags: 0x0},
+ 684: {region: 0x53, script: 0x61, flags: 0x0},
+ 685: {region: 0x96, script: 0x5b, flags: 0x0},
+ 686: {region: 0x9d, script: 0x5, flags: 0x0},
+ 687: {region: 0x136, script: 0x5b, flags: 0x0},
+ 688: {region: 0x166, script: 0x5b, flags: 0x0},
+ 689: {region: 0x166, script: 0x5b, flags: 0x0},
+ 690: {region: 0x9a, script: 0xe9, flags: 0x0},
+ 691: {region: 0x9f, script: 0x5b, flags: 0x0},
+ 692: {region: 0x166, script: 0x5b, flags: 0x0},
+ 693: {region: 0x4b, script: 0x5b, flags: 0x0},
+ 694: {region: 0x166, script: 0x5b, flags: 0x0},
+ 695: {region: 0x166, script: 0x5b, flags: 0x0},
+ 696: {region: 0xb0, script: 0x58, flags: 0x0},
+ 697: {region: 0x166, script: 0x5b, flags: 0x0},
+ 698: {region: 0x166, script: 0x5b, flags: 0x0},
+ 699: {region: 0x4b, script: 0x5b, flags: 0x0},
+ 700: {region: 0x166, script: 0x5b, flags: 0x0},
+ 701: {region: 0x166, script: 0x5b, flags: 0x0},
+ 702: {region: 0x163, script: 0x5b, flags: 0x0},
+ 703: {region: 0x9d, script: 0x5, flags: 0x0},
+ 704: {region: 0xb7, script: 0x5b, flags: 0x0},
+ 705: {region: 0xb9, script: 0x5b, flags: 0x0},
+ 706: {region: 0x4b, script: 0x5b, flags: 0x0},
+ 707: {region: 0x4b, script: 0x5b, flags: 0x0},
+ 708: {region: 0xa5, script: 0x5b, flags: 0x0},
+ 709: {region: 0xa5, script: 0x5b, flags: 0x0},
+ 710: {region: 0x9d, script: 0x5, flags: 0x0},
+ 711: {region: 0xb9, script: 0x5b, flags: 0x0},
+ 712: {region: 0x124, script: 0xee, flags: 0x0},
+ 713: {region: 0x53, script: 0x3b, flags: 0x0},
+ 714: {region: 0x12c, script: 0x5b, flags: 0x0},
+ 715: {region: 0x96, script: 0x5b, flags: 0x0},
+ 716: {region: 0x52, script: 0x5b, flags: 0x0},
+ 717: {region: 0x9a, script: 0x22, flags: 0x0},
+ 718: {region: 0x9a, script: 0x22, flags: 0x0},
+ 719: {region: 0x96, script: 0x5b, flags: 0x0},
+ 720: {region: 0x23, script: 0x3, flags: 0x1},
+ 721: {region: 0xa5, script: 0x5b, flags: 0x0},
+ 722: {region: 0x166, script: 0x5b, flags: 0x0},
+ 723: {region: 0xd0, script: 0x5b, flags: 0x0},
+ 724: {region: 0x166, script: 0x5b, flags: 0x0},
+ 725: {region: 0x166, script: 0x5b, flags: 0x0},
+ 726: {region: 0x166, script: 0x5b, flags: 0x0},
+ 727: {region: 0x166, script: 0x5b, flags: 0x0},
+ 728: {region: 0x166, script: 0x5b, flags: 0x0},
+ 729: {region: 0x166, script: 0x5b, flags: 0x0},
+ 730: {region: 0x166, script: 0x5b, flags: 0x0},
+ 731: {region: 0x166, script: 0x5b, flags: 0x0},
+ 732: {region: 0x166, script: 0x5b, flags: 0x0},
+ 733: {region: 0x166, script: 0x5b, flags: 0x0},
+ 734: {region: 0x166, script: 0x5b, flags: 0x0},
+ 735: {region: 0x166, script: 0x5, flags: 0x0},
+ 736: {region: 0x107, script: 0x20, flags: 0x0},
+ 737: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 738: {region: 0x166, script: 0x5b, flags: 0x0},
+ 739: {region: 0x96, script: 0x5b, flags: 0x0},
+ 740: {region: 0x166, script: 0x2c, flags: 0x0},
+ 741: {region: 0x166, script: 0x5b, flags: 0x0},
+ 742: {region: 0x166, script: 0x5b, flags: 0x0},
+ 743: {region: 0x166, script: 0x5b, flags: 0x0},
+ 744: {region: 0x113, script: 0x5b, flags: 0x0},
+ 745: {region: 0xa5, script: 0x5b, flags: 0x0},
+ 746: {region: 0x166, script: 0x5b, flags: 0x0},
+ 747: {region: 0x166, script: 0x5b, flags: 0x0},
+ 748: {region: 0x124, script: 0x5, flags: 0x0},
+ 749: {region: 0xcd, script: 0x5b, flags: 0x0},
+ 750: {region: 0x166, script: 0x5b, flags: 0x0},
+ 751: {region: 0x166, script: 0x5b, flags: 0x0},
+ 752: {region: 0x166, script: 0x5b, flags: 0x0},
+ 753: {region: 0xc0, script: 0x5b, flags: 0x0},
+ 754: {region: 0xd2, script: 0x5b, flags: 0x0},
+ 755: {region: 0x166, script: 0x5b, flags: 0x0},
+ 756: {region: 0x52, script: 0x5b, flags: 0x0},
+ 757: {region: 0xdc, script: 0x22, flags: 0x0},
+ 758: {region: 0x130, script: 0x5b, flags: 0x0},
+ 759: {region: 0xc1, script: 0x5b, flags: 0x0},
+ 760: {region: 0x166, script: 0x5b, flags: 0x0},
+ 761: {region: 0x166, script: 0x5b, flags: 0x0},
+ 762: {region: 0xe1, script: 0x5b, flags: 0x0},
+ 763: {region: 0x166, script: 0x5b, flags: 0x0},
+ 764: {region: 0x96, script: 0x5b, flags: 0x0},
+ 765: {region: 0x9c, script: 0x3d, flags: 0x0},
+ 766: {region: 0x166, script: 0x5b, flags: 0x0},
+ 767: {region: 0xc3, script: 0x20, flags: 0x0},
+ 768: {region: 0x166, script: 0x5, flags: 0x0},
+ 769: {region: 0x166, script: 0x5b, flags: 0x0},
+ 770: {region: 0x166, script: 0x5b, flags: 0x0},
+ 771: {region: 0x166, script: 0x5b, flags: 0x0},
+ 772: {region: 0x9a, script: 0x6f, flags: 0x0},
+ 773: {region: 0x166, script: 0x5b, flags: 0x0},
+ 774: {region: 0x166, script: 0x5b, flags: 0x0},
+ 775: {region: 0x10c, script: 0x5b, flags: 0x0},
+ 776: {region: 0x166, script: 0x5b, flags: 0x0},
+ 777: {region: 0x166, script: 0x5b, flags: 0x0},
+ 778: {region: 0x166, script: 0x5b, flags: 0x0},
+ 779: {region: 0x26, script: 0x3, flags: 0x1},
+ 780: {region: 0x166, script: 0x5b, flags: 0x0},
+ 781: {region: 0x166, script: 0x5b, flags: 0x0},
+ 782: {region: 0x9a, script: 0xe, flags: 0x0},
+ 783: {region: 0xc5, script: 0x76, flags: 0x0},
+ 785: {region: 0x166, script: 0x5b, flags: 0x0},
+ 786: {region: 0x49, script: 0x5b, flags: 0x0},
+ 787: {region: 0x49, script: 0x5b, flags: 0x0},
+ 788: {region: 0x37, script: 0x5b, flags: 0x0},
+ 789: {region: 0x166, script: 0x5b, flags: 0x0},
+ 790: {region: 0x166, script: 0x5b, flags: 0x0},
+ 791: {region: 0x166, script: 0x5b, flags: 0x0},
+ 792: {region: 0x166, script: 0x5b, flags: 0x0},
+ 793: {region: 0x166, script: 0x5b, flags: 0x0},
+ 794: {region: 0x166, script: 0x5b, flags: 0x0},
+ 795: {region: 0x9a, script: 0x22, flags: 0x0},
+ 796: {region: 0xdc, script: 0x22, flags: 0x0},
+ 797: {region: 0x107, script: 0x20, flags: 0x0},
+ 798: {region: 0x35, script: 0x73, flags: 0x0},
+ 799: {region: 0x29, script: 0x3, flags: 0x1},
+ 800: {region: 0xcc, script: 0x5b, flags: 0x0},
+ 801: {region: 0x166, script: 0x5b, flags: 0x0},
+ 802: {region: 0x166, script: 0x5b, flags: 0x0},
+ 803: {region: 0x166, script: 0x5b, flags: 0x0},
+ 804: {region: 0x9a, script: 0x22, flags: 0x0},
+ 805: {region: 0x52, script: 0x5b, flags: 0x0},
+ 807: {region: 0x166, script: 0x5b, flags: 0x0},
+ 808: {region: 0x136, script: 0x5b, flags: 0x0},
+ 809: {region: 0x166, script: 0x5b, flags: 0x0},
+ 810: {region: 0x166, script: 0x5b, flags: 0x0},
+ 811: {region: 0xe9, script: 0x5, flags: 0x0},
+ 812: {region: 0xc4, script: 0x5b, flags: 0x0},
+ 813: {region: 0x9a, script: 0x22, flags: 0x0},
+ 814: {region: 0x96, script: 0x5b, flags: 0x0},
+ 815: {region: 0x165, script: 0x5b, flags: 0x0},
+ 816: {region: 0x166, script: 0x5b, flags: 0x0},
+ 817: {region: 0xc5, script: 0x76, flags: 0x0},
+ 818: {region: 0x166, script: 0x5b, flags: 0x0},
+ 819: {region: 0x166, script: 0x2c, flags: 0x0},
+ 820: {region: 0x107, script: 0x20, flags: 0x0},
+ 821: {region: 0x166, script: 0x5b, flags: 0x0},
+ 822: {region: 0x132, script: 0x5b, flags: 0x0},
+ 823: {region: 0x9d, script: 0x67, flags: 0x0},
+ 824: {region: 0x166, script: 0x5b, flags: 0x0},
+ 825: {region: 0x166, script: 0x5b, flags: 0x0},
+ 826: {region: 0x9d, script: 0x5, flags: 0x0},
+ 827: {region: 0x166, script: 0x5b, flags: 0x0},
+ 828: {region: 0x166, script: 0x5b, flags: 0x0},
+ 829: {region: 0x166, script: 0x5b, flags: 0x0},
+ 830: {region: 0xde, script: 0x5b, flags: 0x0},
+ 831: {region: 0x166, script: 0x5b, flags: 0x0},
+ 832: {region: 0x166, script: 0x5b, flags: 0x0},
+ 834: {region: 0x166, script: 0x5b, flags: 0x0},
+ 835: {region: 0x53, script: 0x3b, flags: 0x0},
+ 836: {region: 0x9f, script: 0x5b, flags: 0x0},
+ 837: {region: 0xd3, script: 0x5b, flags: 0x0},
+ 838: {region: 0x166, script: 0x5b, flags: 0x0},
+ 839: {region: 0xdb, script: 0x5b, flags: 0x0},
+ 840: {region: 0x166, script: 0x5b, flags: 0x0},
+ 841: {region: 0x166, script: 0x5b, flags: 0x0},
+ 842: {region: 0x166, script: 0x5b, flags: 0x0},
+ 843: {region: 0xd0, script: 0x5b, flags: 0x0},
+ 844: {region: 0x166, script: 0x5b, flags: 0x0},
+ 845: {region: 0x166, script: 0x5b, flags: 0x0},
+ 846: {region: 0x165, script: 0x5b, flags: 0x0},
+ 847: {region: 0xd2, script: 0x5b, flags: 0x0},
+ 848: {region: 0x61, script: 0x5b, flags: 0x0},
+ 849: {region: 0xdc, script: 0x22, flags: 0x0},
+ 850: {region: 0x166, script: 0x5b, flags: 0x0},
+ 851: {region: 0xdc, script: 0x22, flags: 0x0},
+ 852: {region: 0x166, script: 0x5b, flags: 0x0},
+ 853: {region: 0x166, script: 0x5b, flags: 0x0},
+ 854: {region: 0xd3, script: 0x5b, flags: 0x0},
+ 855: {region: 0x166, script: 0x5b, flags: 0x0},
+ 856: {region: 0x166, script: 0x5b, flags: 0x0},
+ 857: {region: 0xd2, script: 0x5b, flags: 0x0},
+ 858: {region: 0x166, script: 0x5b, flags: 0x0},
+ 859: {region: 0xd0, script: 0x5b, flags: 0x0},
+ 860: {region: 0xd0, script: 0x5b, flags: 0x0},
+ 861: {region: 0x166, script: 0x5b, flags: 0x0},
+ 862: {region: 0x166, script: 0x5b, flags: 0x0},
+ 863: {region: 0x96, script: 0x5b, flags: 0x0},
+ 864: {region: 0x166, script: 0x5b, flags: 0x0},
+ 865: {region: 0xe0, script: 0x5b, flags: 0x0},
+ 866: {region: 0x166, script: 0x5b, flags: 0x0},
+ 867: {region: 0x166, script: 0x5b, flags: 0x0},
+ 868: {region: 0x9a, script: 0x5b, flags: 0x0},
+ 869: {region: 0x166, script: 0x5b, flags: 0x0},
+ 870: {region: 0x166, script: 0x5b, flags: 0x0},
+ 871: {region: 0xda, script: 0x5b, flags: 0x0},
+ 872: {region: 0x52, script: 0x5b, flags: 0x0},
+ 873: {region: 0x166, script: 0x5b, flags: 0x0},
+ 874: {region: 0xdb, script: 0x5b, flags: 0x0},
+ 875: {region: 0x166, script: 0x5b, flags: 0x0},
+ 876: {region: 0x52, script: 0x5b, flags: 0x0},
+ 877: {region: 0x166, script: 0x5b, flags: 0x0},
+ 878: {region: 0x166, script: 0x5b, flags: 0x0},
+ 879: {region: 0xdb, script: 0x5b, flags: 0x0},
+ 880: {region: 0x124, script: 0x57, flags: 0x0},
+ 881: {region: 0x9a, script: 0x22, flags: 0x0},
+ 882: {region: 0x10d, script: 0xcb, flags: 0x0},
+ 883: {region: 0x166, script: 0x5b, flags: 0x0},
+ 884: {region: 0x166, script: 0x5b, flags: 0x0},
+ 885: {region: 0x85, script: 0x7e, flags: 0x0},
+ 886: {region: 0x162, script: 0x5b, flags: 0x0},
+ 887: {region: 0x166, script: 0x5b, flags: 0x0},
+ 888: {region: 0x49, script: 0x17, flags: 0x0},
+ 889: {region: 0x166, script: 0x5b, flags: 0x0},
+ 890: {region: 0x162, script: 0x5b, flags: 0x0},
+ 891: {region: 0x166, script: 0x5b, flags: 0x0},
+ 892: {region: 0x166, script: 0x5b, flags: 0x0},
+ 893: {region: 0x166, script: 0x5b, flags: 0x0},
+ 894: {region: 0x166, script: 0x5b, flags: 0x0},
+ 895: {region: 0x166, script: 0x5b, flags: 0x0},
+ 896: {region: 0x118, script: 0x5b, flags: 0x0},
+ 897: {region: 0x166, script: 0x5b, flags: 0x0},
+ 898: {region: 0x166, script: 0x5b, flags: 0x0},
+ 899: {region: 0x136, script: 0x5b, flags: 0x0},
+ 900: {region: 0x166, script: 0x5b, flags: 0x0},
+ 901: {region: 0x53, script: 0x5b, flags: 0x0},
+ 902: {region: 0x166, script: 0x5b, flags: 0x0},
+ 903: {region: 0xcf, script: 0x5b, flags: 0x0},
+ 904: {region: 0x130, script: 0x5b, flags: 0x0},
+ 905: {region: 0x132, script: 0x5b, flags: 0x0},
+ 906: {region: 0x81, script: 0x5b, flags: 0x0},
+ 907: {region: 0x79, script: 0x5b, flags: 0x0},
+ 908: {region: 0x166, script: 0x5b, flags: 0x0},
+ 910: {region: 0x166, script: 0x5b, flags: 0x0},
+ 911: {region: 0x166, script: 0x5b, flags: 0x0},
+ 912: {region: 0x70, script: 0x5b, flags: 0x0},
+ 913: {region: 0x166, script: 0x5b, flags: 0x0},
+ 914: {region: 0x166, script: 0x5b, flags: 0x0},
+ 915: {region: 0x166, script: 0x5b, flags: 0x0},
+ 916: {region: 0x166, script: 0x5b, flags: 0x0},
+ 917: {region: 0x9a, script: 0x83, flags: 0x0},
+ 918: {region: 0x166, script: 0x5b, flags: 0x0},
+ 919: {region: 0x166, script: 0x5, flags: 0x0},
+ 920: {region: 0x7e, script: 0x20, flags: 0x0},
+ 921: {region: 0x136, script: 0x84, flags: 0x0},
+ 922: {region: 0x166, script: 0x5, flags: 0x0},
+ 923: {region: 0xc6, script: 0x82, flags: 0x0},
+ 924: {region: 0x166, script: 0x5b, flags: 0x0},
+ 925: {region: 0x2c, script: 0x3, flags: 0x1},
+ 926: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 927: {region: 0x2f, script: 0x2, flags: 0x1},
+ 928: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 929: {region: 0x30, script: 0x5b, flags: 0x0},
+ 930: {region: 0xf1, script: 0x5b, flags: 0x0},
+ 931: {region: 0x166, script: 0x5b, flags: 0x0},
+ 932: {region: 0x79, script: 0x5b, flags: 0x0},
+ 933: {region: 0xd7, script: 0x5b, flags: 0x0},
+ 934: {region: 0x136, script: 0x5b, flags: 0x0},
+ 935: {region: 0x49, script: 0x5b, flags: 0x0},
+ 936: {region: 0x166, script: 0x5b, flags: 0x0},
+ 937: {region: 0x9d, script: 0xfa, flags: 0x0},
+ 938: {region: 0x166, script: 0x5b, flags: 0x0},
+ 939: {region: 0x61, script: 0x5b, flags: 0x0},
+ 940: {region: 0x166, script: 0x5, flags: 0x0},
+ 941: {region: 0xb1, script: 0x90, flags: 0x0},
+ 943: {region: 0x166, script: 0x5b, flags: 0x0},
+ 944: {region: 0x166, script: 0x5b, flags: 0x0},
+ 945: {region: 0x9a, script: 0x12, flags: 0x0},
+ 946: {region: 0xa5, script: 0x5b, flags: 0x0},
+ 947: {region: 0xea, script: 0x5b, flags: 0x0},
+ 948: {region: 0x166, script: 0x5b, flags: 0x0},
+ 949: {region: 0x9f, script: 0x5b, flags: 0x0},
+ 950: {region: 0x166, script: 0x5b, flags: 0x0},
+ 951: {region: 0x166, script: 0x5b, flags: 0x0},
+ 952: {region: 0x88, script: 0x34, flags: 0x0},
+ 953: {region: 0x76, script: 0x5b, flags: 0x0},
+ 954: {region: 0x166, script: 0x5b, flags: 0x0},
+ 955: {region: 0xe9, script: 0x4e, flags: 0x0},
+ 956: {region: 0x9d, script: 0x5, flags: 0x0},
+ 957: {region: 0x1, script: 0x5b, flags: 0x0},
+ 958: {region: 0x24, script: 0x5, flags: 0x0},
+ 959: {region: 0x166, script: 0x5b, flags: 0x0},
+ 960: {region: 0x41, script: 0x5b, flags: 0x0},
+ 961: {region: 0x166, script: 0x5b, flags: 0x0},
+ 962: {region: 0x7b, script: 0x5b, flags: 0x0},
+ 963: {region: 0x166, script: 0x5b, flags: 0x0},
+ 964: {region: 0xe5, script: 0x5b, flags: 0x0},
+ 965: {region: 0x8a, script: 0x5b, flags: 0x0},
+ 966: {region: 0x6a, script: 0x5b, flags: 0x0},
+ 967: {region: 0x166, script: 0x5b, flags: 0x0},
+ 968: {region: 0x9a, script: 0x22, flags: 0x0},
+ 969: {region: 0x166, script: 0x5b, flags: 0x0},
+ 970: {region: 0x103, script: 0x5b, flags: 0x0},
+ 971: {region: 0x96, script: 0x5b, flags: 0x0},
+ 972: {region: 0x166, script: 0x5b, flags: 0x0},
+ 973: {region: 0x166, script: 0x5b, flags: 0x0},
+ 974: {region: 0x9f, script: 0x5b, flags: 0x0},
+ 975: {region: 0x166, script: 0x5, flags: 0x0},
+ 976: {region: 0x9a, script: 0x5b, flags: 0x0},
+ 977: {region: 0x31, script: 0x2, flags: 0x1},
+ 978: {region: 0xdc, script: 0x22, flags: 0x0},
+ 979: {region: 0x35, script: 0xe, flags: 0x0},
+ 980: {region: 0x4e, script: 0x5b, flags: 0x0},
+ 981: {region: 0x73, script: 0x5b, flags: 0x0},
+ 982: {region: 0x4e, script: 0x5b, flags: 0x0},
+ 983: {region: 0x9d, script: 0x5, flags: 0x0},
+ 984: {region: 0x10d, script: 0x5b, flags: 0x0},
+ 985: {region: 0x3a, script: 0x5b, flags: 0x0},
+ 986: {region: 0x166, script: 0x5b, flags: 0x0},
+ 987: {region: 0xd2, script: 0x5b, flags: 0x0},
+ 988: {region: 0x105, script: 0x5b, flags: 0x0},
+ 989: {region: 0x96, script: 0x5b, flags: 0x0},
+ 990: {region: 0x130, script: 0x5b, flags: 0x0},
+ 991: {region: 0x166, script: 0x5b, flags: 0x0},
+ 992: {region: 0x166, script: 0x5b, flags: 0x0},
+ 993: {region: 0x74, script: 0x5b, flags: 0x0},
+ 994: {region: 0x107, script: 0x20, flags: 0x0},
+ 995: {region: 0x131, script: 0x20, flags: 0x0},
+ 996: {region: 0x10a, script: 0x5b, flags: 0x0},
+ 997: {region: 0x108, script: 0x5b, flags: 0x0},
+ 998: {region: 0x130, script: 0x5b, flags: 0x0},
+ 999: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1000: {region: 0xa3, script: 0x4c, flags: 0x0},
+ 1001: {region: 0x9a, script: 0x22, flags: 0x0},
+ 1002: {region: 0x81, script: 0x5b, flags: 0x0},
+ 1003: {region: 0x107, script: 0x20, flags: 0x0},
+ 1004: {region: 0xa5, script: 0x5b, flags: 0x0},
+ 1005: {region: 0x96, script: 0x5b, flags: 0x0},
+ 1006: {region: 0x9a, script: 0x5b, flags: 0x0},
+ 1007: {region: 0x115, script: 0x5b, flags: 0x0},
+ 1008: {region: 0x9a, script: 0xcf, flags: 0x0},
+ 1009: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1010: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1011: {region: 0x130, script: 0x5b, flags: 0x0},
+ 1012: {region: 0x9f, script: 0x5b, flags: 0x0},
+ 1013: {region: 0x9a, script: 0x22, flags: 0x0},
+ 1014: {region: 0x166, script: 0x5, flags: 0x0},
+ 1015: {region: 0x9f, script: 0x5b, flags: 0x0},
+ 1016: {region: 0x7c, script: 0x5b, flags: 0x0},
+ 1017: {region: 0x49, script: 0x5b, flags: 0x0},
+ 1018: {region: 0x33, script: 0x4, flags: 0x1},
+ 1019: {region: 0x9f, script: 0x5b, flags: 0x0},
+ 1020: {region: 0x9d, script: 0x5, flags: 0x0},
+ 1021: {region: 0xdb, script: 0x5b, flags: 0x0},
+ 1022: {region: 0x4f, script: 0x5b, flags: 0x0},
+ 1023: {region: 0xd2, script: 0x5b, flags: 0x0},
+ 1024: {region: 0xd0, script: 0x5b, flags: 0x0},
+ 1025: {region: 0xc4, script: 0x5b, flags: 0x0},
+ 1026: {region: 0x4c, script: 0x5b, flags: 0x0},
+ 1027: {region: 0x97, script: 0x80, flags: 0x0},
+ 1028: {region: 0xb7, script: 0x5b, flags: 0x0},
+ 1029: {region: 0x166, script: 0x2c, flags: 0x0},
+ 1030: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1032: {region: 0xbb, script: 0xeb, flags: 0x0},
+ 1033: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1034: {region: 0xc5, script: 0x76, flags: 0x0},
+ 1035: {region: 0x166, script: 0x5, flags: 0x0},
+ 1036: {region: 0xb4, script: 0xd6, flags: 0x0},
+ 1037: {region: 0x70, script: 0x5b, flags: 0x0},
+ 1038: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1039: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1040: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1041: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1042: {region: 0x112, script: 0x5b, flags: 0x0},
+ 1043: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1044: {region: 0xe9, script: 0x5, flags: 0x0},
+ 1045: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1046: {region: 0x110, script: 0x5b, flags: 0x0},
+ 1047: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1048: {region: 0xea, script: 0x5b, flags: 0x0},
+ 1049: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1050: {region: 0x96, script: 0x5b, flags: 0x0},
+ 1051: {region: 0x143, script: 0x5b, flags: 0x0},
+ 1052: {region: 0x10d, script: 0x5b, flags: 0x0},
+ 1054: {region: 0x10d, script: 0x5b, flags: 0x0},
+ 1055: {region: 0x73, script: 0x5b, flags: 0x0},
+ 1056: {region: 0x98, script: 0xcc, flags: 0x0},
+ 1057: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1058: {region: 0x73, script: 0x5b, flags: 0x0},
+ 1059: {region: 0x165, script: 0x5b, flags: 0x0},
+ 1060: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1061: {region: 0xc4, script: 0x5b, flags: 0x0},
+ 1062: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1063: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1064: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1065: {region: 0x116, script: 0x5b, flags: 0x0},
+ 1066: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1067: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1068: {region: 0x124, script: 0xee, flags: 0x0},
+ 1069: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1070: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1071: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1072: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1073: {region: 0x27, script: 0x5b, flags: 0x0},
+ 1074: {region: 0x37, script: 0x5, flags: 0x1},
+ 1075: {region: 0x9a, script: 0xd9, flags: 0x0},
+ 1076: {region: 0x117, script: 0x5b, flags: 0x0},
+ 1077: {region: 0x115, script: 0x5b, flags: 0x0},
+ 1078: {region: 0x9a, script: 0x22, flags: 0x0},
+ 1079: {region: 0x162, script: 0x5b, flags: 0x0},
+ 1080: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1081: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1082: {region: 0x6e, script: 0x5b, flags: 0x0},
+ 1083: {region: 0x162, script: 0x5b, flags: 0x0},
+ 1084: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1085: {region: 0x61, script: 0x5b, flags: 0x0},
+ 1086: {region: 0x96, script: 0x5b, flags: 0x0},
+ 1087: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1088: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1089: {region: 0x130, script: 0x5b, flags: 0x0},
+ 1090: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1091: {region: 0x85, script: 0x5b, flags: 0x0},
+ 1092: {region: 0x10d, script: 0x5b, flags: 0x0},
+ 1093: {region: 0x130, script: 0x5b, flags: 0x0},
+ 1094: {region: 0x160, script: 0x5, flags: 0x0},
+ 1095: {region: 0x4b, script: 0x5b, flags: 0x0},
+ 1096: {region: 0x61, script: 0x5b, flags: 0x0},
+ 1097: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1098: {region: 0x9a, script: 0x22, flags: 0x0},
+ 1099: {region: 0x96, script: 0x5b, flags: 0x0},
+ 1100: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1101: {region: 0x35, script: 0xe, flags: 0x0},
+ 1102: {region: 0x9c, script: 0xde, flags: 0x0},
+ 1103: {region: 0xea, script: 0x5b, flags: 0x0},
+ 1104: {region: 0x9a, script: 0xe6, flags: 0x0},
+ 1105: {region: 0xdc, script: 0x22, flags: 0x0},
+ 1106: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1107: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1108: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1109: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1110: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1111: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1112: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1113: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1114: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 1115: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1116: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1117: {region: 0x9a, script: 0x53, flags: 0x0},
+ 1118: {region: 0x53, script: 0xe4, flags: 0x0},
+ 1119: {region: 0xdc, script: 0x22, flags: 0x0},
+ 1120: {region: 0xdc, script: 0x22, flags: 0x0},
+ 1121: {region: 0x9a, script: 0xe9, flags: 0x0},
+ 1122: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1123: {region: 0x113, script: 0x5b, flags: 0x0},
+ 1124: {region: 0x132, script: 0x5b, flags: 0x0},
+ 1125: {region: 0x127, script: 0x5b, flags: 0x0},
+ 1126: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1127: {region: 0x3c, script: 0x3, flags: 0x1},
+ 1128: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1129: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1130: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1131: {region: 0x124, script: 0xee, flags: 0x0},
+ 1132: {region: 0xdc, script: 0x22, flags: 0x0},
+ 1133: {region: 0xdc, script: 0x22, flags: 0x0},
+ 1134: {region: 0xdc, script: 0x22, flags: 0x0},
+ 1135: {region: 0x70, script: 0x2c, flags: 0x0},
+ 1136: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1137: {region: 0x6e, script: 0x2c, flags: 0x0},
+ 1138: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1139: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1140: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1141: {region: 0xd7, script: 0x5b, flags: 0x0},
+ 1142: {region: 0x128, script: 0x5b, flags: 0x0},
+ 1143: {region: 0x126, script: 0x5b, flags: 0x0},
+ 1144: {region: 0x32, script: 0x5b, flags: 0x0},
+ 1145: {region: 0xdc, script: 0x22, flags: 0x0},
+ 1146: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 1147: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1148: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1149: {region: 0x32, script: 0x5b, flags: 0x0},
+ 1150: {region: 0xd5, script: 0x5b, flags: 0x0},
+ 1151: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1152: {region: 0x162, script: 0x5b, flags: 0x0},
+ 1153: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1154: {region: 0x12a, script: 0x5b, flags: 0x0},
+ 1155: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1156: {region: 0xcf, script: 0x5b, flags: 0x0},
+ 1157: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1158: {region: 0xe7, script: 0x5b, flags: 0x0},
+ 1159: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1160: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1161: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1162: {region: 0x12c, script: 0x5b, flags: 0x0},
+ 1163: {region: 0x12c, script: 0x5b, flags: 0x0},
+ 1164: {region: 0x12f, script: 0x5b, flags: 0x0},
+ 1165: {region: 0x166, script: 0x5, flags: 0x0},
+ 1166: {region: 0x162, script: 0x5b, flags: 0x0},
+ 1167: {region: 0x88, script: 0x34, flags: 0x0},
+ 1168: {region: 0xdc, script: 0x22, flags: 0x0},
+ 1169: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 1170: {region: 0x43, script: 0xef, flags: 0x0},
+ 1171: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1172: {region: 0x107, script: 0x20, flags: 0x0},
+ 1173: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1174: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1175: {region: 0x132, script: 0x5b, flags: 0x0},
+ 1176: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1177: {region: 0x124, script: 0xee, flags: 0x0},
+ 1178: {region: 0x32, script: 0x5b, flags: 0x0},
+ 1179: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1180: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1181: {region: 0xcf, script: 0x5b, flags: 0x0},
+ 1182: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1183: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1184: {region: 0x12e, script: 0x5b, flags: 0x0},
+ 1185: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1187: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1188: {region: 0xd5, script: 0x5b, flags: 0x0},
+ 1189: {region: 0x53, script: 0xe7, flags: 0x0},
+ 1190: {region: 0xe6, script: 0x5b, flags: 0x0},
+ 1191: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1192: {region: 0x107, script: 0x20, flags: 0x0},
+ 1193: {region: 0xbb, script: 0x5b, flags: 0x0},
+ 1194: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1195: {region: 0x107, script: 0x20, flags: 0x0},
+ 1196: {region: 0x3f, script: 0x4, flags: 0x1},
+ 1197: {region: 0x11d, script: 0xf3, flags: 0x0},
+ 1198: {region: 0x131, script: 0x20, flags: 0x0},
+ 1199: {region: 0x76, script: 0x5b, flags: 0x0},
+ 1200: {region: 0x2a, script: 0x5b, flags: 0x0},
+ 1202: {region: 0x43, script: 0x3, flags: 0x1},
+ 1203: {region: 0x9a, script: 0xe, flags: 0x0},
+ 1204: {region: 0xe9, script: 0x5, flags: 0x0},
+ 1205: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1206: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1207: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1208: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1209: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1210: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1211: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1212: {region: 0x46, script: 0x4, flags: 0x1},
+ 1213: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1214: {region: 0xb5, script: 0xf4, flags: 0x0},
+ 1215: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1216: {region: 0x162, script: 0x5b, flags: 0x0},
+ 1217: {region: 0x9f, script: 0x5b, flags: 0x0},
+ 1218: {region: 0x107, script: 0x5b, flags: 0x0},
+ 1219: {region: 0x13f, script: 0x5b, flags: 0x0},
+ 1220: {region: 0x11c, script: 0x5b, flags: 0x0},
+ 1221: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1222: {region: 0x36, script: 0x5b, flags: 0x0},
+ 1223: {region: 0x61, script: 0x5b, flags: 0x0},
+ 1224: {region: 0xd2, script: 0x5b, flags: 0x0},
+ 1225: {region: 0x1, script: 0x5b, flags: 0x0},
+ 1226: {region: 0x107, script: 0x5b, flags: 0x0},
+ 1227: {region: 0x6b, script: 0x5b, flags: 0x0},
+ 1228: {region: 0x130, script: 0x5b, flags: 0x0},
+ 1229: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1230: {region: 0x36, script: 0x5b, flags: 0x0},
+ 1231: {region: 0x4e, script: 0x5b, flags: 0x0},
+ 1232: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1233: {region: 0x70, script: 0x2c, flags: 0x0},
+ 1234: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1235: {region: 0xe8, script: 0x5b, flags: 0x0},
+ 1236: {region: 0x2f, script: 0x5b, flags: 0x0},
+ 1237: {region: 0x9a, script: 0xe9, flags: 0x0},
+ 1238: {region: 0x9a, script: 0x22, flags: 0x0},
+ 1239: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1240: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1241: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1242: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1243: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1244: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1245: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1246: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1247: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1248: {region: 0x141, script: 0x5b, flags: 0x0},
+ 1249: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1250: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1251: {region: 0xa9, script: 0x5, flags: 0x0},
+ 1252: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1253: {region: 0x115, script: 0x5b, flags: 0x0},
+ 1254: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1255: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1256: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1257: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1258: {region: 0x9a, script: 0x22, flags: 0x0},
+ 1259: {region: 0x53, script: 0x3b, flags: 0x0},
+ 1260: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1261: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1262: {region: 0x41, script: 0x5b, flags: 0x0},
+ 1263: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1264: {region: 0x12c, script: 0x18, flags: 0x0},
+ 1265: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1266: {region: 0x162, script: 0x5b, flags: 0x0},
+ 1267: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1268: {region: 0x12c, script: 0x63, flags: 0x0},
+ 1269: {region: 0x12c, script: 0x64, flags: 0x0},
+ 1270: {region: 0x7e, script: 0x2e, flags: 0x0},
+ 1271: {region: 0x53, script: 0x68, flags: 0x0},
+ 1272: {region: 0x10c, script: 0x6d, flags: 0x0},
+ 1273: {region: 0x109, script: 0x79, flags: 0x0},
+ 1274: {region: 0x9a, script: 0x22, flags: 0x0},
+ 1275: {region: 0x132, script: 0x5b, flags: 0x0},
+ 1276: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1277: {region: 0x9d, script: 0x93, flags: 0x0},
+ 1278: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1279: {region: 0x15f, script: 0xce, flags: 0x0},
+ 1280: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1281: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1282: {region: 0xdc, script: 0x22, flags: 0x0},
+ 1283: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1284: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1285: {region: 0xd2, script: 0x5b, flags: 0x0},
+ 1286: {region: 0x76, script: 0x5b, flags: 0x0},
+ 1287: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1288: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1289: {region: 0x52, script: 0x5b, flags: 0x0},
+ 1290: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1291: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1292: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1293: {region: 0x52, script: 0x5b, flags: 0x0},
+ 1294: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1295: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1296: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1297: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1298: {region: 0x1, script: 0x3e, flags: 0x0},
+ 1299: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1300: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1301: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1302: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1303: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1304: {region: 0xd7, script: 0x5b, flags: 0x0},
+ 1305: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1306: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1307: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1308: {region: 0x41, script: 0x5b, flags: 0x0},
+ 1309: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1310: {region: 0xd0, script: 0x5b, flags: 0x0},
+ 1311: {region: 0x4a, script: 0x3, flags: 0x1},
+ 1312: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1313: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1314: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1315: {region: 0x53, script: 0x5b, flags: 0x0},
+ 1316: {region: 0x10c, script: 0x5b, flags: 0x0},
+ 1318: {region: 0xa9, script: 0x5, flags: 0x0},
+ 1319: {region: 0xda, script: 0x5b, flags: 0x0},
+ 1320: {region: 0xbb, script: 0xeb, flags: 0x0},
+ 1321: {region: 0x4d, script: 0x14, flags: 0x1},
+ 1322: {region: 0x53, script: 0x7f, flags: 0x0},
+ 1323: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1324: {region: 0x123, script: 0x5b, flags: 0x0},
+ 1325: {region: 0xd1, script: 0x5b, flags: 0x0},
+ 1326: {region: 0x166, script: 0x5b, flags: 0x0},
+ 1327: {region: 0x162, script: 0x5b, flags: 0x0},
+ 1329: {region: 0x12c, script: 0x5b, flags: 0x0},
+}
+
+// likelyLangList holds lists info associated with likelyLang.
+// Size: 582 bytes, 97 elements
+var likelyLangList = [97]likelyScriptRegion{
+ 0: {region: 0x9d, script: 0x7, flags: 0x0},
+ 1: {region: 0xa2, script: 0x7a, flags: 0x2},
+ 2: {region: 0x11d, script: 0x87, flags: 0x2},
+ 3: {region: 0x32, script: 0x5b, flags: 0x0},
+ 4: {region: 0x9c, script: 0x5, flags: 0x4},
+ 5: {region: 0x9d, script: 0x5, flags: 0x4},
+ 6: {region: 0x107, script: 0x20, flags: 0x4},
+ 7: {region: 0x9d, script: 0x5, flags: 0x2},
+ 8: {region: 0x107, script: 0x20, flags: 0x0},
+ 9: {region: 0x38, script: 0x2f, flags: 0x2},
+ 10: {region: 0x136, script: 0x5b, flags: 0x0},
+ 11: {region: 0x7c, script: 0xd1, flags: 0x2},
+ 12: {region: 0x115, script: 0x5b, flags: 0x0},
+ 13: {region: 0x85, script: 0x1, flags: 0x2},
+ 14: {region: 0x5e, script: 0x1f, flags: 0x0},
+ 15: {region: 0x88, script: 0x60, flags: 0x2},
+ 16: {region: 0xd7, script: 0x5b, flags: 0x0},
+ 17: {region: 0x52, script: 0x5, flags: 0x4},
+ 18: {region: 0x10c, script: 0x5, flags: 0x4},
+ 19: {region: 0xaf, script: 0x20, flags: 0x0},
+ 20: {region: 0x24, script: 0x5, flags: 0x4},
+ 21: {region: 0x53, script: 0x5, flags: 0x4},
+ 22: {region: 0x9d, script: 0x5, flags: 0x4},
+ 23: {region: 0xc6, script: 0x5, flags: 0x4},
+ 24: {region: 0x53, script: 0x5, flags: 0x2},
+ 25: {region: 0x12c, script: 0x5b, flags: 0x0},
+ 26: {region: 0xb1, script: 0x5, flags: 0x4},
+ 27: {region: 0x9c, script: 0x5, flags: 0x2},
+ 28: {region: 0xa6, script: 0x20, flags: 0x0},
+ 29: {region: 0x53, script: 0x5, flags: 0x4},
+ 30: {region: 0x12c, script: 0x5b, flags: 0x4},
+ 31: {region: 0x53, script: 0x5, flags: 0x2},
+ 32: {region: 0x12c, script: 0x5b, flags: 0x2},
+ 33: {region: 0xdc, script: 0x22, flags: 0x0},
+ 34: {region: 0x9a, script: 0x5e, flags: 0x2},
+ 35: {region: 0x84, script: 0x5b, flags: 0x0},
+ 36: {region: 0x85, script: 0x7e, flags: 0x4},
+ 37: {region: 0x85, script: 0x7e, flags: 0x2},
+ 38: {region: 0xc6, script: 0x20, flags: 0x0},
+ 39: {region: 0x53, script: 0x71, flags: 0x4},
+ 40: {region: 0x53, script: 0x71, flags: 0x2},
+ 41: {region: 0xd1, script: 0x5b, flags: 0x0},
+ 42: {region: 0x4a, script: 0x5, flags: 0x4},
+ 43: {region: 0x96, script: 0x5, flags: 0x4},
+ 44: {region: 0x9a, script: 0x36, flags: 0x0},
+ 45: {region: 0xe9, script: 0x5, flags: 0x4},
+ 46: {region: 0xe9, script: 0x5, flags: 0x2},
+ 47: {region: 0x9d, script: 0x8d, flags: 0x0},
+ 48: {region: 0x53, script: 0x8e, flags: 0x2},
+ 49: {region: 0xbb, script: 0xeb, flags: 0x0},
+ 50: {region: 0xda, script: 0x5b, flags: 0x4},
+ 51: {region: 0xe9, script: 0x5, flags: 0x0},
+ 52: {region: 0x9a, script: 0x22, flags: 0x2},
+ 53: {region: 0x9a, script: 0x50, flags: 0x2},
+ 54: {region: 0x9a, script: 0xd5, flags: 0x2},
+ 55: {region: 0x106, script: 0x20, flags: 0x0},
+ 56: {region: 0xbe, script: 0x5b, flags: 0x4},
+ 57: {region: 0x105, script: 0x5b, flags: 0x4},
+ 58: {region: 0x107, script: 0x5b, flags: 0x4},
+ 59: {region: 0x12c, script: 0x5b, flags: 0x4},
+ 60: {region: 0x125, script: 0x20, flags: 0x0},
+ 61: {region: 0xe9, script: 0x5, flags: 0x4},
+ 62: {region: 0xe9, script: 0x5, flags: 0x2},
+ 63: {region: 0x53, script: 0x5, flags: 0x0},
+ 64: {region: 0xaf, script: 0x20, flags: 0x4},
+ 65: {region: 0xc6, script: 0x20, flags: 0x4},
+ 66: {region: 0xaf, script: 0x20, flags: 0x2},
+ 67: {region: 0x9a, script: 0xe, flags: 0x0},
+ 68: {region: 0xdc, script: 0x22, flags: 0x4},
+ 69: {region: 0xdc, script: 0x22, flags: 0x2},
+ 70: {region: 0x138, script: 0x5b, flags: 0x0},
+ 71: {region: 0x24, script: 0x5, flags: 0x4},
+ 72: {region: 0x53, script: 0x20, flags: 0x4},
+ 73: {region: 0x24, script: 0x5, flags: 0x2},
+ 74: {region: 0x8e, script: 0x3c, flags: 0x0},
+ 75: {region: 0x53, script: 0x3b, flags: 0x4},
+ 76: {region: 0x53, script: 0x3b, flags: 0x2},
+ 77: {region: 0x53, script: 0x3b, flags: 0x0},
+ 78: {region: 0x2f, script: 0x3c, flags: 0x4},
+ 79: {region: 0x3e, script: 0x3c, flags: 0x4},
+ 80: {region: 0x7c, script: 0x3c, flags: 0x4},
+ 81: {region: 0x7f, script: 0x3c, flags: 0x4},
+ 82: {region: 0x8e, script: 0x3c, flags: 0x4},
+ 83: {region: 0x96, script: 0x3c, flags: 0x4},
+ 84: {region: 0xc7, script: 0x3c, flags: 0x4},
+ 85: {region: 0xd1, script: 0x3c, flags: 0x4},
+ 86: {region: 0xe3, script: 0x3c, flags: 0x4},
+ 87: {region: 0xe6, script: 0x3c, flags: 0x4},
+ 88: {region: 0xe8, script: 0x3c, flags: 0x4},
+ 89: {region: 0x117, script: 0x3c, flags: 0x4},
+ 90: {region: 0x124, script: 0x3c, flags: 0x4},
+ 91: {region: 0x12f, script: 0x3c, flags: 0x4},
+ 92: {region: 0x136, script: 0x3c, flags: 0x4},
+ 93: {region: 0x13f, script: 0x3c, flags: 0x4},
+ 94: {region: 0x12f, script: 0x11, flags: 0x2},
+ 95: {region: 0x12f, script: 0x37, flags: 0x2},
+ 96: {region: 0x12f, script: 0x3c, flags: 0x2},
+}
+
+type likelyLangScript struct {
+ lang uint16
+ script uint16
+ flags uint8
+}
+
+// likelyRegion is a lookup table, indexed by regionID, for the most likely
+// languages and scripts given incomplete information. If more entries exist
+// for a given regionID, lang and script are the index and size respectively
+// of the list in likelyRegionList.
+// TODO: exclude containers and user-definable regions from the list.
+// Size: 2154 bytes, 359 elements
+var likelyRegion = [359]likelyLangScript{
+ 34: {lang: 0xd7, script: 0x5b, flags: 0x0},
+ 35: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 36: {lang: 0x0, script: 0x2, flags: 0x1},
+ 39: {lang: 0x2, script: 0x2, flags: 0x1},
+ 40: {lang: 0x4, script: 0x2, flags: 0x1},
+ 42: {lang: 0x3c0, script: 0x5b, flags: 0x0},
+ 43: {lang: 0x0, script: 0x5b, flags: 0x0},
+ 44: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 45: {lang: 0x41b, script: 0x5b, flags: 0x0},
+ 46: {lang: 0x10d, script: 0x5b, flags: 0x0},
+ 48: {lang: 0x367, script: 0x5b, flags: 0x0},
+ 49: {lang: 0x444, script: 0x5b, flags: 0x0},
+ 50: {lang: 0x58, script: 0x5b, flags: 0x0},
+ 51: {lang: 0x6, script: 0x2, flags: 0x1},
+ 53: {lang: 0xa5, script: 0xe, flags: 0x0},
+ 54: {lang: 0x367, script: 0x5b, flags: 0x0},
+ 55: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 56: {lang: 0x7e, script: 0x20, flags: 0x0},
+ 57: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 58: {lang: 0x3d9, script: 0x5b, flags: 0x0},
+ 59: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 60: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 62: {lang: 0x31f, script: 0x5b, flags: 0x0},
+ 63: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 64: {lang: 0x3a1, script: 0x5b, flags: 0x0},
+ 65: {lang: 0x3c0, script: 0x5b, flags: 0x0},
+ 67: {lang: 0x8, script: 0x2, flags: 0x1},
+ 69: {lang: 0x0, script: 0x5b, flags: 0x0},
+ 71: {lang: 0x71, script: 0x20, flags: 0x0},
+ 73: {lang: 0x512, script: 0x3e, flags: 0x2},
+ 74: {lang: 0x31f, script: 0x5, flags: 0x2},
+ 75: {lang: 0x445, script: 0x5b, flags: 0x0},
+ 76: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 77: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 78: {lang: 0x10d, script: 0x5b, flags: 0x0},
+ 79: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 81: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 82: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 83: {lang: 0xa, script: 0x4, flags: 0x1},
+ 84: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 85: {lang: 0x0, script: 0x5b, flags: 0x0},
+ 87: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 90: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 91: {lang: 0x3c0, script: 0x5b, flags: 0x0},
+ 92: {lang: 0x3a1, script: 0x5b, flags: 0x0},
+ 94: {lang: 0xe, script: 0x2, flags: 0x1},
+ 95: {lang: 0xfa, script: 0x5b, flags: 0x0},
+ 97: {lang: 0x10d, script: 0x5b, flags: 0x0},
+ 99: {lang: 0x1, script: 0x5b, flags: 0x0},
+ 100: {lang: 0x101, script: 0x5b, flags: 0x0},
+ 102: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 104: {lang: 0x10, script: 0x2, flags: 0x1},
+ 105: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 106: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 107: {lang: 0x140, script: 0x5b, flags: 0x0},
+ 108: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 109: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 110: {lang: 0x46f, script: 0x2c, flags: 0x0},
+ 111: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 112: {lang: 0x12, script: 0x2, flags: 0x1},
+ 114: {lang: 0x10d, script: 0x5b, flags: 0x0},
+ 115: {lang: 0x151, script: 0x5b, flags: 0x0},
+ 116: {lang: 0x1c0, script: 0x22, flags: 0x2},
+ 119: {lang: 0x158, script: 0x5b, flags: 0x0},
+ 121: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 123: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 124: {lang: 0x14, script: 0x2, flags: 0x1},
+ 126: {lang: 0x16, script: 0x3, flags: 0x1},
+ 127: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 129: {lang: 0x21, script: 0x5b, flags: 0x0},
+ 131: {lang: 0x245, script: 0x5b, flags: 0x0},
+ 133: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 134: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 135: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 136: {lang: 0x19, script: 0x2, flags: 0x1},
+ 137: {lang: 0x0, script: 0x5b, flags: 0x0},
+ 138: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 140: {lang: 0x3c0, script: 0x5b, flags: 0x0},
+ 142: {lang: 0x529, script: 0x3c, flags: 0x0},
+ 143: {lang: 0x0, script: 0x5b, flags: 0x0},
+ 144: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 145: {lang: 0x1d1, script: 0x5b, flags: 0x0},
+ 146: {lang: 0x1d4, script: 0x5b, flags: 0x0},
+ 147: {lang: 0x1d5, script: 0x5b, flags: 0x0},
+ 149: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 150: {lang: 0x1b, script: 0x2, flags: 0x1},
+ 152: {lang: 0x1bc, script: 0x3e, flags: 0x0},
+ 154: {lang: 0x1d, script: 0x3, flags: 0x1},
+ 156: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 157: {lang: 0x20, script: 0x2, flags: 0x1},
+ 158: {lang: 0x1f8, script: 0x5b, flags: 0x0},
+ 159: {lang: 0x1f9, script: 0x5b, flags: 0x0},
+ 162: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 163: {lang: 0x200, script: 0x49, flags: 0x0},
+ 165: {lang: 0x445, script: 0x5b, flags: 0x0},
+ 166: {lang: 0x28a, script: 0x20, flags: 0x0},
+ 167: {lang: 0x22, script: 0x3, flags: 0x1},
+ 169: {lang: 0x25, script: 0x2, flags: 0x1},
+ 171: {lang: 0x254, script: 0x54, flags: 0x0},
+ 172: {lang: 0x254, script: 0x54, flags: 0x0},
+ 173: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 175: {lang: 0x3e2, script: 0x20, flags: 0x0},
+ 176: {lang: 0x27, script: 0x2, flags: 0x1},
+ 177: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 179: {lang: 0x10d, script: 0x5b, flags: 0x0},
+ 180: {lang: 0x40c, script: 0xd6, flags: 0x0},
+ 182: {lang: 0x43b, script: 0x5b, flags: 0x0},
+ 183: {lang: 0x2c0, script: 0x5b, flags: 0x0},
+ 184: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 185: {lang: 0x2c7, script: 0x5b, flags: 0x0},
+ 186: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 187: {lang: 0x29, script: 0x2, flags: 0x1},
+ 188: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 189: {lang: 0x2b, script: 0x2, flags: 0x1},
+ 190: {lang: 0x432, script: 0x5b, flags: 0x0},
+ 191: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 192: {lang: 0x2f1, script: 0x5b, flags: 0x0},
+ 195: {lang: 0x2d, script: 0x2, flags: 0x1},
+ 196: {lang: 0xa0, script: 0x5b, flags: 0x0},
+ 197: {lang: 0x2f, script: 0x2, flags: 0x1},
+ 198: {lang: 0x31, script: 0x2, flags: 0x1},
+ 199: {lang: 0x33, script: 0x2, flags: 0x1},
+ 201: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 202: {lang: 0x35, script: 0x2, flags: 0x1},
+ 204: {lang: 0x320, script: 0x5b, flags: 0x0},
+ 205: {lang: 0x37, script: 0x3, flags: 0x1},
+ 206: {lang: 0x128, script: 0xed, flags: 0x0},
+ 208: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 209: {lang: 0x31f, script: 0x5b, flags: 0x0},
+ 210: {lang: 0x3c0, script: 0x5b, flags: 0x0},
+ 211: {lang: 0x16, script: 0x5b, flags: 0x0},
+ 212: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 213: {lang: 0x1b4, script: 0x5b, flags: 0x0},
+ 215: {lang: 0x1b4, script: 0x5, flags: 0x2},
+ 217: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 218: {lang: 0x367, script: 0x5b, flags: 0x0},
+ 219: {lang: 0x347, script: 0x5b, flags: 0x0},
+ 220: {lang: 0x351, script: 0x22, flags: 0x0},
+ 226: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 227: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 229: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 230: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 231: {lang: 0x486, script: 0x5b, flags: 0x0},
+ 232: {lang: 0x153, script: 0x5b, flags: 0x0},
+ 233: {lang: 0x3a, script: 0x3, flags: 0x1},
+ 234: {lang: 0x3b3, script: 0x5b, flags: 0x0},
+ 235: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 237: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 238: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 239: {lang: 0x3c0, script: 0x5b, flags: 0x0},
+ 241: {lang: 0x3a2, script: 0x5b, flags: 0x0},
+ 242: {lang: 0x194, script: 0x5b, flags: 0x0},
+ 244: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 259: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 261: {lang: 0x3d, script: 0x2, flags: 0x1},
+ 262: {lang: 0x432, script: 0x20, flags: 0x0},
+ 263: {lang: 0x3f, script: 0x2, flags: 0x1},
+ 264: {lang: 0x3e5, script: 0x5b, flags: 0x0},
+ 265: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 267: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 268: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 269: {lang: 0x41, script: 0x2, flags: 0x1},
+ 272: {lang: 0x416, script: 0x5b, flags: 0x0},
+ 273: {lang: 0x347, script: 0x5b, flags: 0x0},
+ 274: {lang: 0x43, script: 0x2, flags: 0x1},
+ 276: {lang: 0x1f9, script: 0x5b, flags: 0x0},
+ 277: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 278: {lang: 0x429, script: 0x5b, flags: 0x0},
+ 279: {lang: 0x367, script: 0x5b, flags: 0x0},
+ 281: {lang: 0x3c0, script: 0x5b, flags: 0x0},
+ 283: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 285: {lang: 0x45, script: 0x2, flags: 0x1},
+ 289: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 290: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 291: {lang: 0x47, script: 0x2, flags: 0x1},
+ 292: {lang: 0x49, script: 0x3, flags: 0x1},
+ 293: {lang: 0x4c, script: 0x2, flags: 0x1},
+ 294: {lang: 0x477, script: 0x5b, flags: 0x0},
+ 295: {lang: 0x3c0, script: 0x5b, flags: 0x0},
+ 296: {lang: 0x476, script: 0x5b, flags: 0x0},
+ 297: {lang: 0x4e, script: 0x2, flags: 0x1},
+ 298: {lang: 0x482, script: 0x5b, flags: 0x0},
+ 300: {lang: 0x50, script: 0x4, flags: 0x1},
+ 302: {lang: 0x4a0, script: 0x5b, flags: 0x0},
+ 303: {lang: 0x54, script: 0x2, flags: 0x1},
+ 304: {lang: 0x445, script: 0x5b, flags: 0x0},
+ 305: {lang: 0x56, script: 0x3, flags: 0x1},
+ 306: {lang: 0x445, script: 0x5b, flags: 0x0},
+ 310: {lang: 0x512, script: 0x3e, flags: 0x2},
+ 311: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 312: {lang: 0x4bc, script: 0x5b, flags: 0x0},
+ 313: {lang: 0x1f9, script: 0x5b, flags: 0x0},
+ 316: {lang: 0x13e, script: 0x5b, flags: 0x0},
+ 319: {lang: 0x4c3, script: 0x5b, flags: 0x0},
+ 320: {lang: 0x8a, script: 0x5b, flags: 0x0},
+ 321: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 323: {lang: 0x41b, script: 0x5b, flags: 0x0},
+ 334: {lang: 0x59, script: 0x2, flags: 0x1},
+ 351: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 352: {lang: 0x5b, script: 0x2, flags: 0x1},
+ 357: {lang: 0x423, script: 0x5b, flags: 0x0},
+}
+
+// likelyRegionList holds lists info associated with likelyRegion.
+// Size: 558 bytes, 93 elements
+var likelyRegionList = [93]likelyLangScript{
+ 0: {lang: 0x148, script: 0x5, flags: 0x0},
+ 1: {lang: 0x476, script: 0x5b, flags: 0x0},
+ 2: {lang: 0x431, script: 0x5b, flags: 0x0},
+ 3: {lang: 0x2ff, script: 0x20, flags: 0x0},
+ 4: {lang: 0x1d7, script: 0x8, flags: 0x0},
+ 5: {lang: 0x274, script: 0x5b, flags: 0x0},
+ 6: {lang: 0xb7, script: 0x5b, flags: 0x0},
+ 7: {lang: 0x432, script: 0x20, flags: 0x0},
+ 8: {lang: 0x12d, script: 0xef, flags: 0x0},
+ 9: {lang: 0x351, script: 0x22, flags: 0x0},
+ 10: {lang: 0x529, script: 0x3b, flags: 0x0},
+ 11: {lang: 0x4ac, script: 0x5, flags: 0x0},
+ 12: {lang: 0x523, script: 0x5b, flags: 0x0},
+ 13: {lang: 0x29a, script: 0xee, flags: 0x0},
+ 14: {lang: 0x136, script: 0x34, flags: 0x0},
+ 15: {lang: 0x48a, script: 0x5b, flags: 0x0},
+ 16: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 17: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 18: {lang: 0x27, script: 0x2c, flags: 0x0},
+ 19: {lang: 0x139, script: 0x5b, flags: 0x0},
+ 20: {lang: 0x26a, script: 0x5, flags: 0x2},
+ 21: {lang: 0x512, script: 0x3e, flags: 0x2},
+ 22: {lang: 0x210, script: 0x2e, flags: 0x0},
+ 23: {lang: 0x5, script: 0x20, flags: 0x0},
+ 24: {lang: 0x274, script: 0x5b, flags: 0x0},
+ 25: {lang: 0x136, script: 0x34, flags: 0x0},
+ 26: {lang: 0x2ff, script: 0x20, flags: 0x0},
+ 27: {lang: 0x1e1, script: 0x5b, flags: 0x0},
+ 28: {lang: 0x31f, script: 0x5, flags: 0x0},
+ 29: {lang: 0x1be, script: 0x22, flags: 0x0},
+ 30: {lang: 0x4b4, script: 0x5, flags: 0x0},
+ 31: {lang: 0x236, script: 0x76, flags: 0x0},
+ 32: {lang: 0x148, script: 0x5, flags: 0x0},
+ 33: {lang: 0x476, script: 0x5b, flags: 0x0},
+ 34: {lang: 0x24a, script: 0x4f, flags: 0x0},
+ 35: {lang: 0xe6, script: 0x5, flags: 0x0},
+ 36: {lang: 0x226, script: 0xee, flags: 0x0},
+ 37: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 38: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 39: {lang: 0x2b8, script: 0x58, flags: 0x0},
+ 40: {lang: 0x226, script: 0xee, flags: 0x0},
+ 41: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 42: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 43: {lang: 0x3dc, script: 0x5b, flags: 0x0},
+ 44: {lang: 0x4ae, script: 0x20, flags: 0x0},
+ 45: {lang: 0x2ff, script: 0x20, flags: 0x0},
+ 46: {lang: 0x431, script: 0x5b, flags: 0x0},
+ 47: {lang: 0x331, script: 0x76, flags: 0x0},
+ 48: {lang: 0x213, script: 0x5b, flags: 0x0},
+ 49: {lang: 0x30b, script: 0x20, flags: 0x0},
+ 50: {lang: 0x242, script: 0x5, flags: 0x0},
+ 51: {lang: 0x529, script: 0x3c, flags: 0x0},
+ 52: {lang: 0x3c0, script: 0x5b, flags: 0x0},
+ 53: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 54: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 55: {lang: 0x2ed, script: 0x5b, flags: 0x0},
+ 56: {lang: 0x4b4, script: 0x5, flags: 0x0},
+ 57: {lang: 0x88, script: 0x22, flags: 0x0},
+ 58: {lang: 0x4b4, script: 0x5, flags: 0x0},
+ 59: {lang: 0x4b4, script: 0x5, flags: 0x0},
+ 60: {lang: 0xbe, script: 0x22, flags: 0x0},
+ 61: {lang: 0x3dc, script: 0x5b, flags: 0x0},
+ 62: {lang: 0x7e, script: 0x20, flags: 0x0},
+ 63: {lang: 0x3e2, script: 0x20, flags: 0x0},
+ 64: {lang: 0x267, script: 0x5b, flags: 0x0},
+ 65: {lang: 0x444, script: 0x5b, flags: 0x0},
+ 66: {lang: 0x512, script: 0x3e, flags: 0x0},
+ 67: {lang: 0x412, script: 0x5b, flags: 0x0},
+ 68: {lang: 0x4ae, script: 0x20, flags: 0x0},
+ 69: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 70: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 71: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 72: {lang: 0x35, script: 0x5, flags: 0x0},
+ 73: {lang: 0x46b, script: 0xee, flags: 0x0},
+ 74: {lang: 0x2ec, script: 0x5, flags: 0x0},
+ 75: {lang: 0x30f, script: 0x76, flags: 0x0},
+ 76: {lang: 0x467, script: 0x20, flags: 0x0},
+ 77: {lang: 0x148, script: 0x5, flags: 0x0},
+ 78: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 79: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 80: {lang: 0x48a, script: 0x5b, flags: 0x0},
+ 81: {lang: 0x58, script: 0x5, flags: 0x0},
+ 82: {lang: 0x219, script: 0x20, flags: 0x0},
+ 83: {lang: 0x81, script: 0x34, flags: 0x0},
+ 84: {lang: 0x529, script: 0x3c, flags: 0x0},
+ 85: {lang: 0x48c, script: 0x5b, flags: 0x0},
+ 86: {lang: 0x4ae, script: 0x20, flags: 0x0},
+ 87: {lang: 0x512, script: 0x3e, flags: 0x0},
+ 88: {lang: 0x3b3, script: 0x5b, flags: 0x0},
+ 89: {lang: 0x431, script: 0x5b, flags: 0x0},
+ 90: {lang: 0x432, script: 0x20, flags: 0x0},
+ 91: {lang: 0x15e, script: 0x5b, flags: 0x0},
+ 92: {lang: 0x446, script: 0x5, flags: 0x0},
+}
+
+type likelyTag struct {
+ lang uint16
+ region uint16
+ script uint16
+}
+
+// Size: 198 bytes, 33 elements
+var likelyRegionGroup = [33]likelyTag{
+ 1: {lang: 0x139, region: 0xd7, script: 0x5b},
+ 2: {lang: 0x139, region: 0x136, script: 0x5b},
+ 3: {lang: 0x3c0, region: 0x41, script: 0x5b},
+ 4: {lang: 0x139, region: 0x2f, script: 0x5b},
+ 5: {lang: 0x139, region: 0xd7, script: 0x5b},
+ 6: {lang: 0x13e, region: 0xd0, script: 0x5b},
+ 7: {lang: 0x445, region: 0x130, script: 0x5b},
+ 8: {lang: 0x3a, region: 0x6c, script: 0x5},
+ 9: {lang: 0x445, region: 0x4b, script: 0x5b},
+ 10: {lang: 0x139, region: 0x162, script: 0x5b},
+ 11: {lang: 0x139, region: 0x136, script: 0x5b},
+ 12: {lang: 0x139, region: 0x136, script: 0x5b},
+ 13: {lang: 0x13e, region: 0x5a, script: 0x5b},
+ 14: {lang: 0x529, region: 0x53, script: 0x3b},
+ 15: {lang: 0x1be, region: 0x9a, script: 0x22},
+ 16: {lang: 0x1e1, region: 0x96, script: 0x5b},
+ 17: {lang: 0x1f9, region: 0x9f, script: 0x5b},
+ 18: {lang: 0x139, region: 0x2f, script: 0x5b},
+ 19: {lang: 0x139, region: 0xe7, script: 0x5b},
+ 20: {lang: 0x139, region: 0x8b, script: 0x5b},
+ 21: {lang: 0x41b, region: 0x143, script: 0x5b},
+ 22: {lang: 0x529, region: 0x53, script: 0x3b},
+ 23: {lang: 0x4bc, region: 0x138, script: 0x5b},
+ 24: {lang: 0x3a, region: 0x109, script: 0x5},
+ 25: {lang: 0x3e2, region: 0x107, script: 0x20},
+ 26: {lang: 0x3e2, region: 0x107, script: 0x20},
+ 27: {lang: 0x139, region: 0x7c, script: 0x5b},
+ 28: {lang: 0x10d, region: 0x61, script: 0x5b},
+ 29: {lang: 0x139, region: 0xd7, script: 0x5b},
+ 30: {lang: 0x13e, region: 0x1f, script: 0x5b},
+ 31: {lang: 0x139, region: 0x9b, script: 0x5b},
+ 32: {lang: 0x139, region: 0x7c, script: 0x5b},
+}
+
+// Size: 264 bytes, 33 elements
+var regionContainment = [33]uint64{
+ // Entry 0 - 1F
+ 0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008,
+ 0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080,
+ 0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c,
+ 0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000,
+ 0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000,
+ 0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000,
+ 0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000,
+ 0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000,
+ // Entry 20 - 3F
+ 0x0000000100000000,
+}
+
+// regionInclusion maps region identifiers to sets of regions in regionInclusionBits,
+// where each set holds all groupings that are directly connected in a region
+// containment graph.
+// Size: 359 bytes, 359 elements
+var regionInclusion = [359]uint8{
+ // Entry 0 - 3F
+ 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06,
+ 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e,
+ 0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16,
+ 0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e,
+ 0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23,
+ 0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b,
+ 0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d,
+ 0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28,
+ // Entry 40 - 7F
+ 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33,
+ 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d,
+ 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x21, 0x34,
+ 0x23, 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e,
+ 0x35, 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21,
+ 0x39, 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a,
+ 0x2f, 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c,
+ 0x21, 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28,
+ // Entry 80 - BF
+ 0x2c, 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27,
+ 0x3a, 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22,
+ 0x34, 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38,
+ 0x24, 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a,
+ 0x2c, 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31,
+ 0x3c, 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d,
+ 0x31, 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38,
+ 0x2a, 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26,
+ // Entry C0 - FF
+ 0x2f, 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36,
+ 0x3c, 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f,
+ 0x34, 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d,
+ 0x21, 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24,
+ 0x29, 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b,
+ 0x31, 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a,
+ 0x21, 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f,
+ 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
+ // Entry 100 - 13F
+ 0x21, 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33,
+ 0x2f, 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d,
+ 0x3a, 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28,
+ 0x2f, 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22,
+ 0x26, 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31,
+ 0x3d, 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36,
+ 0x2f, 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28,
+ 0x3d, 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31,
+ // Entry 140 - 17F
+ 0x3b, 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21,
+ 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21,
+ 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
+ 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24,
+ 0x2f, 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21,
+}
+
+// regionInclusionBits is an array of bit vectors where every vector represents
+// a set of region groupings. These sets are used to compute the distance
+// between two regions for the purpose of language matching.
+// Size: 584 bytes, 73 elements
+var regionInclusionBits = [73]uint64{
+ // Entry 0 - 1F
+ 0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808,
+ 0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082,
+ 0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d,
+ 0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000,
+ 0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010,
+ 0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000,
+ 0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000,
+ 0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010,
+ // Entry 20 - 3F
+ 0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000,
+ 0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200,
+ 0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000,
+ 0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080,
+ 0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000,
+ 0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000,
+ 0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000,
+ 0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3,
+ // Entry 40 - 5F
+ 0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813,
+ 0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001,
+ 0x0000000102020001,
+}
+
+// regionInclusionNext marks, for each entry in regionInclusionBits, the set of
+// all groups that are reachable from the groups set in the respective entry.
+// Size: 73 bytes, 73 elements
+var regionInclusionNext = [73]uint8{
+ // Entry 0 - 3F
+ 0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01,
+ 0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16,
+ 0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16,
+ 0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04,
+ 0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09,
+ 0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07,
+ 0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46,
+ 0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e,
+ // Entry 40 - 7F
+ 0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43,
+ 0x43,
+}
+
+type parentRel struct {
+ lang uint16
+ script uint16
+ maxScript uint16
+ toRegion uint16
+ fromRegion []uint16
+}
+
+// Size: 414 bytes, 5 elements
+var parents = [5]parentRel{
+ 0: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5d, 0x5e, 0x62, 0x65, 0x6e, 0x74, 0x75, 0x76, 0x7c, 0x7d, 0x80, 0x81, 0x82, 0x84, 0x8d, 0x8e, 0x97, 0x98, 0x99, 0x9a, 0x9b, 0xa0, 0xa1, 0xa5, 0xa8, 0xaa, 0xae, 0xb2, 0xb5, 0xb6, 0xc0, 0xc7, 0xcb, 0xcc, 0xcd, 0xcf, 0xd1, 0xd3, 0xd6, 0xd7, 0xde, 0xe0, 0xe1, 0xe7, 0xe8, 0xe9, 0xec, 0xf1, 0x108, 0x10a, 0x10b, 0x10c, 0x10e, 0x10f, 0x113, 0x118, 0x11c, 0x11e, 0x120, 0x126, 0x12a, 0x12d, 0x12e, 0x130, 0x132, 0x13a, 0x13d, 0x140, 0x143, 0x162, 0x163, 0x165}},
+ 1: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x61, 0x64, 0x73, 0xda, 0x10d, 0x110}},
+ 2: {lang: 0x13e, script: 0x0, maxScript: 0x5b, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x57, 0x5a, 0x66, 0x6a, 0x8a, 0x90, 0xd0, 0xd9, 0xe3, 0xe5, 0xed, 0xf2, 0x11b, 0x136, 0x137, 0x13c}},
+ 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5b, toRegion: 0xef, fromRegion: []uint16{0x2a, 0x4e, 0x5b, 0x87, 0x8c, 0xb8, 0xc7, 0xd2, 0x119, 0x127}},
+ 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8e, fromRegion: []uint16{0xc7}},
+}
+
+// Total table size 30466 bytes (29KiB); checksum: 7544152B
diff --git a/vendor/golang.org/x/text/internal/language/tags.go b/vendor/golang.org/x/text/internal/language/tags.go
@@ -0,0 +1,48 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed.
+// It simplifies safe initialization of Tag values.
+func MustParse(s string) Tag {
+ t, err := Parse(s)
+ if err != nil {
+ panic(err)
+ }
+ return t
+}
+
+// MustParseBase is like ParseBase, but panics if the given base cannot be parsed.
+// It simplifies safe initialization of Base values.
+func MustParseBase(s string) Language {
+ b, err := ParseBase(s)
+ if err != nil {
+ panic(err)
+ }
+ return b
+}
+
+// MustParseScript is like ParseScript, but panics if the given script cannot be
+// parsed. It simplifies safe initialization of Script values.
+func MustParseScript(s string) Script {
+ scr, err := ParseScript(s)
+ if err != nil {
+ panic(err)
+ }
+ return scr
+}
+
+// MustParseRegion is like ParseRegion, but panics if the given region cannot be
+// parsed. It simplifies safe initialization of Region values.
+func MustParseRegion(s string) Region {
+ r, err := ParseRegion(s)
+ if err != nil {
+ panic(err)
+ }
+ return r
+}
+
+// Und is the root language.
+var Und Tag
diff --git a/vendor/golang.org/x/text/internal/tag/tag.go b/vendor/golang.org/x/text/internal/tag/tag.go
@@ -0,0 +1,100 @@
+// Copyright 2015 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package tag contains functionality handling tags and related data.
+package tag // import "golang.org/x/text/internal/tag"
+
+import "sort"
+
+// An Index converts tags to a compact numeric value.
+//
+// All elements are of size 4. Tags may be up to 4 bytes long. Excess bytes can
+// be used to store additional information about the tag.
+type Index string
+
+// Elem returns the element data at the given index.
+func (s Index) Elem(x int) string {
+ return string(s[x*4 : x*4+4])
+}
+
+// Index reports the index of the given key or -1 if it could not be found.
+// Only the first len(key) bytes from the start of the 4-byte entries will be
+// considered for the search and the first match in Index will be returned.
+func (s Index) Index(key []byte) int {
+ n := len(key)
+ // search the index of the first entry with an equal or higher value than
+ // key in s.
+ index := sort.Search(len(s)/4, func(i int) bool {
+ return cmp(s[i*4:i*4+n], key) != -1
+ })
+ i := index * 4
+ if cmp(s[i:i+len(key)], key) != 0 {
+ return -1
+ }
+ return index
+}
+
+// Next finds the next occurrence of key after index x, which must have been
+// obtained from a call to Index using the same key. It returns x+1 or -1.
+func (s Index) Next(key []byte, x int) int {
+ if x++; x*4 < len(s) && cmp(s[x*4:x*4+len(key)], key) == 0 {
+ return x
+ }
+ return -1
+}
+
+// cmp returns an integer comparing a and b lexicographically.
+func cmp(a Index, b []byte) int {
+ n := len(a)
+ if len(b) < n {
+ n = len(b)
+ }
+ for i, c := range b[:n] {
+ switch {
+ case a[i] > c:
+ return 1
+ case a[i] < c:
+ return -1
+ }
+ }
+ switch {
+ case len(a) < len(b):
+ return -1
+ case len(a) > len(b):
+ return 1
+ }
+ return 0
+}
+
+// Compare returns an integer comparing a and b lexicographically.
+func Compare(a string, b []byte) int {
+ return cmp(Index(a), b)
+}
+
+// FixCase reformats b to the same pattern of cases as form.
+// If returns false if string b is malformed.
+func FixCase(form string, b []byte) bool {
+ if len(form) != len(b) {
+ return false
+ }
+ for i, c := range b {
+ if form[i] <= 'Z' {
+ if c >= 'a' {
+ c -= 'z' - 'Z'
+ }
+ if c < 'A' || 'Z' < c {
+ return false
+ }
+ } else {
+ if c <= 'Z' {
+ c += 'z' - 'Z'
+ }
+ if c < 'a' || 'z' < c {
+ return false
+ }
+ }
+ b[i] = c
+ }
+ return true
+}
diff --git a/vendor/golang.org/x/text/language/coverage.go b/vendor/golang.org/x/text/language/coverage.go
@@ -0,0 +1,187 @@
+// Copyright 2014 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+ "fmt"
+ "sort"
+
+ "golang.org/x/text/internal/language"
+)
+
+// The Coverage interface is used to define the level of coverage of an
+// internationalization service. Note that not all types are supported by all
+// services. As lists may be generated on the fly, it is recommended that users
+// of a Coverage cache the results.
+type Coverage interface {
+ // Tags returns the list of supported tags.
+ Tags() []Tag
+
+ // BaseLanguages returns the list of supported base languages.
+ BaseLanguages() []Base
+
+ // Scripts returns the list of supported scripts.
+ Scripts() []Script
+
+ // Regions returns the list of supported regions.
+ Regions() []Region
+}
+
+var (
+ // Supported defines a Coverage that lists all supported subtags. Tags
+ // always returns nil.
+ Supported Coverage = allSubtags{}
+)
+
+// TODO:
+// - Support Variants, numbering systems.
+// - CLDR coverage levels.
+// - Set of common tags defined in this package.
+
+type allSubtags struct{}
+
+// Regions returns the list of supported regions. As all regions are in a
+// consecutive range, it simply returns a slice of numbers in increasing order.
+// The "undefined" region is not returned.
+func (s allSubtags) Regions() []Region {
+ reg := make([]Region, language.NumRegions)
+ for i := range reg {
+ reg[i] = Region{language.Region(i + 1)}
+ }
+ return reg
+}
+
+// Scripts returns the list of supported scripts. As all scripts are in a
+// consecutive range, it simply returns a slice of numbers in increasing order.
+// The "undefined" script is not returned.
+func (s allSubtags) Scripts() []Script {
+ scr := make([]Script, language.NumScripts)
+ for i := range scr {
+ scr[i] = Script{language.Script(i + 1)}
+ }
+ return scr
+}
+
+// BaseLanguages returns the list of all supported base languages. It generates
+// the list by traversing the internal structures.
+func (s allSubtags) BaseLanguages() []Base {
+ bs := language.BaseLanguages()
+ base := make([]Base, len(bs))
+ for i, b := range bs {
+ base[i] = Base{b}
+ }
+ return base
+}
+
+// Tags always returns nil.
+func (s allSubtags) Tags() []Tag {
+ return nil
+}
+
+// coverage is used by NewCoverage which is used as a convenient way for
+// creating Coverage implementations for partially defined data. Very often a
+// package will only need to define a subset of slices. coverage provides a
+// convenient way to do this. Moreover, packages using NewCoverage, instead of
+// their own implementation, will not break if later new slice types are added.
+type coverage struct {
+ tags func() []Tag
+ bases func() []Base
+ scripts func() []Script
+ regions func() []Region
+}
+
+func (s *coverage) Tags() []Tag {
+ if s.tags == nil {
+ return nil
+ }
+ return s.tags()
+}
+
+// bases implements sort.Interface and is used to sort base languages.
+type bases []Base
+
+func (b bases) Len() int {
+ return len(b)
+}
+
+func (b bases) Swap(i, j int) {
+ b[i], b[j] = b[j], b[i]
+}
+
+func (b bases) Less(i, j int) bool {
+ return b[i].langID < b[j].langID
+}
+
+// BaseLanguages returns the result from calling s.bases if it is specified or
+// otherwise derives the set of supported base languages from tags.
+func (s *coverage) BaseLanguages() []Base {
+ if s.bases == nil {
+ tags := s.Tags()
+ if len(tags) == 0 {
+ return nil
+ }
+ a := make([]Base, len(tags))
+ for i, t := range tags {
+ a[i] = Base{language.Language(t.lang())}
+ }
+ sort.Sort(bases(a))
+ k := 0
+ for i := 1; i < len(a); i++ {
+ if a[k] != a[i] {
+ k++
+ a[k] = a[i]
+ }
+ }
+ return a[:k+1]
+ }
+ return s.bases()
+}
+
+func (s *coverage) Scripts() []Script {
+ if s.scripts == nil {
+ return nil
+ }
+ return s.scripts()
+}
+
+func (s *coverage) Regions() []Region {
+ if s.regions == nil {
+ return nil
+ }
+ return s.regions()
+}
+
+// NewCoverage returns a Coverage for the given lists. It is typically used by
+// packages providing internationalization services to define their level of
+// coverage. A list may be of type []T or func() []T, where T is either Tag,
+// Base, Script or Region. The returned Coverage derives the value for Bases
+// from Tags if no func or slice for []Base is specified. For other unspecified
+// types the returned Coverage will return nil for the respective methods.
+func NewCoverage(list ...interface{}) Coverage {
+ s := &coverage{}
+ for _, x := range list {
+ switch v := x.(type) {
+ case func() []Base:
+ s.bases = v
+ case func() []Script:
+ s.scripts = v
+ case func() []Region:
+ s.regions = v
+ case func() []Tag:
+ s.tags = v
+ case []Base:
+ s.bases = func() []Base { return v }
+ case []Script:
+ s.scripts = func() []Script { return v }
+ case []Region:
+ s.regions = func() []Region { return v }
+ case []Tag:
+ s.tags = func() []Tag { return v }
+ default:
+ panic(fmt.Sprintf("language: unsupported set type %T", v))
+ }
+ }
+ return s
+}
diff --git a/vendor/golang.org/x/text/language/doc.go b/vendor/golang.org/x/text/language/doc.go
@@ -0,0 +1,98 @@
+// Copyright 2017 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package language implements BCP 47 language tags and related functionality.
+//
+// The most important function of package language is to match a list of
+// user-preferred languages to a list of supported languages.
+// It alleviates the developer of dealing with the complexity of this process
+// and provides the user with the best experience
+// (see https://blog.golang.org/matchlang).
+//
+// # Matching preferred against supported languages
+//
+// A Matcher for an application that supports English, Australian English,
+// Danish, and standard Mandarin can be created as follows:
+//
+// var matcher = language.NewMatcher([]language.Tag{
+// language.English, // The first language is used as fallback.
+// language.MustParse("en-AU"),
+// language.Danish,
+// language.Chinese,
+// })
+//
+// This list of supported languages is typically implied by the languages for
+// which there exists translations of the user interface.
+//
+// User-preferred languages usually come as a comma-separated list of BCP 47
+// language tags.
+// The MatchString finds best matches for such strings:
+//
+// handler(w http.ResponseWriter, r *http.Request) {
+// lang, _ := r.Cookie("lang")
+// accept := r.Header.Get("Accept-Language")
+// tag, _ := language.MatchStrings(matcher, lang.String(), accept)
+//
+// // tag should now be used for the initialization of any
+// // locale-specific service.
+// }
+//
+// The Matcher's Match method can be used to match Tags directly.
+//
+// Matchers are aware of the intricacies of equivalence between languages, such
+// as deprecated subtags, legacy tags, macro languages, mutual
+// intelligibility between scripts and languages, and transparently passing
+// BCP 47 user configuration.
+// For instance, it will know that a reader of Bokmål Danish can read Norwegian
+// and will know that Cantonese ("yue") is a good match for "zh-HK".
+//
+// # Using match results
+//
+// To guarantee a consistent user experience to the user it is important to
+// use the same language tag for the selection of any locale-specific services.
+// For example, it is utterly confusing to substitute spelled-out numbers
+// or dates in one language in text of another language.
+// More subtly confusing is using the wrong sorting order or casing
+// algorithm for a certain language.
+//
+// All the packages in x/text that provide locale-specific services
+// (e.g. collate, cases) should be initialized with the tag that was
+// obtained at the start of an interaction with the user.
+//
+// Note that Tag that is returned by Match and MatchString may differ from any
+// of the supported languages, as it may contain carried over settings from
+// the user tags.
+// This may be inconvenient when your application has some additional
+// locale-specific data for your supported languages.
+// Match and MatchString both return the index of the matched supported tag
+// to simplify associating such data with the matched tag.
+//
+// # Canonicalization
+//
+// If one uses the Matcher to compare languages one does not need to
+// worry about canonicalization.
+//
+// The meaning of a Tag varies per application. The language package
+// therefore delays canonicalization and preserves information as much
+// as possible. The Matcher, however, will always take into account that
+// two different tags may represent the same language.
+//
+// By default, only legacy and deprecated tags are converted into their
+// canonical equivalent. All other information is preserved. This approach makes
+// the confidence scores more accurate and allows matchers to distinguish
+// between variants that are otherwise lost.
+//
+// As a consequence, two tags that should be treated as identical according to
+// BCP 47 or CLDR, like "en-Latn" and "en", will be represented differently. The
+// Matcher handles such distinctions, though, and is aware of the
+// equivalence relations. The CanonType type can be used to alter the
+// canonicalization form.
+//
+// # References
+//
+// BCP 47 - Tags for Identifying Languages http://tools.ietf.org/html/bcp47
+package language // import "golang.org/x/text/language"
+
+// TODO: explanation on how to match languages for your own locale-specific
+// service.
diff --git a/vendor/golang.org/x/text/language/language.go b/vendor/golang.org/x/text/language/language.go
@@ -0,0 +1,605 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:generate go run gen.go -output tables.go
+
+package language
+
+// TODO: Remove above NOTE after:
+// - verifying that tables are dropped correctly (most notably matcher tables).
+
+import (
+ "strings"
+
+ "golang.org/x/text/internal/language"
+ "golang.org/x/text/internal/language/compact"
+)
+
+// Tag represents a BCP 47 language tag. It is used to specify an instance of a
+// specific language or locale. All language tag values are guaranteed to be
+// well-formed.
+type Tag compact.Tag
+
+func makeTag(t language.Tag) (tag Tag) {
+ return Tag(compact.Make(t))
+}
+
+func (t *Tag) tag() language.Tag {
+ return (*compact.Tag)(t).Tag()
+}
+
+func (t *Tag) isCompact() bool {
+ return (*compact.Tag)(t).IsCompact()
+}
+
+// TODO: improve performance.
+func (t *Tag) lang() language.Language { return t.tag().LangID }
+func (t *Tag) region() language.Region { return t.tag().RegionID }
+func (t *Tag) script() language.Script { return t.tag().ScriptID }
+
+// Make is a convenience wrapper for Parse that omits the error.
+// In case of an error, a sensible default is returned.
+func Make(s string) Tag {
+ return Default.Make(s)
+}
+
+// Make is a convenience wrapper for c.Parse that omits the error.
+// In case of an error, a sensible default is returned.
+func (c CanonType) Make(s string) Tag {
+ t, _ := c.Parse(s)
+ return t
+}
+
+// Raw returns the raw base language, script and region, without making an
+// attempt to infer their values.
+func (t Tag) Raw() (b Base, s Script, r Region) {
+ tt := t.tag()
+ return Base{tt.LangID}, Script{tt.ScriptID}, Region{tt.RegionID}
+}
+
+// IsRoot returns true if t is equal to language "und".
+func (t Tag) IsRoot() bool {
+ return compact.Tag(t).IsRoot()
+}
+
+// CanonType can be used to enable or disable various types of canonicalization.
+type CanonType int
+
+const (
+ // Replace deprecated base languages with their preferred replacements.
+ DeprecatedBase CanonType = 1 << iota
+ // Replace deprecated scripts with their preferred replacements.
+ DeprecatedScript
+ // Replace deprecated regions with their preferred replacements.
+ DeprecatedRegion
+ // Remove redundant scripts.
+ SuppressScript
+ // Normalize legacy encodings. This includes legacy languages defined in
+ // CLDR as well as bibliographic codes defined in ISO-639.
+ Legacy
+ // Map the dominant language of a macro language group to the macro language
+ // subtag. For example cmn -> zh.
+ Macro
+ // The CLDR flag should be used if full compatibility with CLDR is required.
+ // There are a few cases where language.Tag may differ from CLDR. To follow all
+ // of CLDR's suggestions, use All|CLDR.
+ CLDR
+
+ // Raw can be used to Compose or Parse without Canonicalization.
+ Raw CanonType = 0
+
+ // Replace all deprecated tags with their preferred replacements.
+ Deprecated = DeprecatedBase | DeprecatedScript | DeprecatedRegion
+
+ // All canonicalizations recommended by BCP 47.
+ BCP47 = Deprecated | SuppressScript
+
+ // All canonicalizations.
+ All = BCP47 | Legacy | Macro
+
+ // Default is the canonicalization used by Parse, Make and Compose. To
+ // preserve as much information as possible, canonicalizations that remove
+ // potentially valuable information are not included. The Matcher is
+ // designed to recognize similar tags that would be the same if
+ // they were canonicalized using All.
+ Default = Deprecated | Legacy
+
+ canonLang = DeprecatedBase | Legacy | Macro
+
+ // TODO: LikelyScript, LikelyRegion: suppress similar to ICU.
+)
+
+// canonicalize returns the canonicalized equivalent of the tag and
+// whether there was any change.
+func canonicalize(c CanonType, t language.Tag) (language.Tag, bool) {
+ if c == Raw {
+ return t, false
+ }
+ changed := false
+ if c&SuppressScript != 0 {
+ if t.LangID.SuppressScript() == t.ScriptID {
+ t.ScriptID = 0
+ changed = true
+ }
+ }
+ if c&canonLang != 0 {
+ for {
+ if l, aliasType := t.LangID.Canonicalize(); l != t.LangID {
+ switch aliasType {
+ case language.Legacy:
+ if c&Legacy != 0 {
+ if t.LangID == _sh && t.ScriptID == 0 {
+ t.ScriptID = _Latn
+ }
+ t.LangID = l
+ changed = true
+ }
+ case language.Macro:
+ if c&Macro != 0 {
+ // We deviate here from CLDR. The mapping "nb" -> "no"
+ // qualifies as a typical Macro language mapping. However,
+ // for legacy reasons, CLDR maps "no", the macro language
+ // code for Norwegian, to the dominant variant "nb". This
+ // change is currently under consideration for CLDR as well.
+ // See https://unicode.org/cldr/trac/ticket/2698 and also
+ // https://unicode.org/cldr/trac/ticket/1790 for some of the
+ // practical implications. TODO: this check could be removed
+ // if CLDR adopts this change.
+ if c&CLDR == 0 || t.LangID != _nb {
+ changed = true
+ t.LangID = l
+ }
+ }
+ case language.Deprecated:
+ if c&DeprecatedBase != 0 {
+ if t.LangID == _mo && t.RegionID == 0 {
+ t.RegionID = _MD
+ }
+ t.LangID = l
+ changed = true
+ // Other canonicalization types may still apply.
+ continue
+ }
+ }
+ } else if c&Legacy != 0 && t.LangID == _no && c&CLDR != 0 {
+ t.LangID = _nb
+ changed = true
+ }
+ break
+ }
+ }
+ if c&DeprecatedScript != 0 {
+ if t.ScriptID == _Qaai {
+ changed = true
+ t.ScriptID = _Zinh
+ }
+ }
+ if c&DeprecatedRegion != 0 {
+ if r := t.RegionID.Canonicalize(); r != t.RegionID {
+ changed = true
+ t.RegionID = r
+ }
+ }
+ return t, changed
+}
+
+// Canonicalize returns the canonicalized equivalent of the tag.
+func (c CanonType) Canonicalize(t Tag) (Tag, error) {
+ // First try fast path.
+ if t.isCompact() {
+ if _, changed := canonicalize(c, compact.Tag(t).Tag()); !changed {
+ return t, nil
+ }
+ }
+ // It is unlikely that one will canonicalize a tag after matching. So do
+ // a slow but simple approach here.
+ if tag, changed := canonicalize(c, t.tag()); changed {
+ tag.RemakeString()
+ return makeTag(tag), nil
+ }
+ return t, nil
+
+}
+
+// Confidence indicates the level of certainty for a given return value.
+// For example, Serbian may be written in Cyrillic or Latin script.
+// The confidence level indicates whether a value was explicitly specified,
+// whether it is typically the only possible value, or whether there is
+// an ambiguity.
+type Confidence int
+
+const (
+ No Confidence = iota // full confidence that there was no match
+ Low // most likely value picked out of a set of alternatives
+ High // value is generally assumed to be the correct match
+ Exact // exact match or explicitly specified value
+)
+
+var confName = []string{"No", "Low", "High", "Exact"}
+
+func (c Confidence) String() string {
+ return confName[c]
+}
+
+// String returns the canonical string representation of the language tag.
+func (t Tag) String() string {
+ return t.tag().String()
+}
+
+// MarshalText implements encoding.TextMarshaler.
+func (t Tag) MarshalText() (text []byte, err error) {
+ return t.tag().MarshalText()
+}
+
+// UnmarshalText implements encoding.TextUnmarshaler.
+func (t *Tag) UnmarshalText(text []byte) error {
+ var tag language.Tag
+ err := tag.UnmarshalText(text)
+ *t = makeTag(tag)
+ return err
+}
+
+// Base returns the base language of the language tag. If the base language is
+// unspecified, an attempt will be made to infer it from the context.
+// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
+func (t Tag) Base() (Base, Confidence) {
+ if b := t.lang(); b != 0 {
+ return Base{b}, Exact
+ }
+ tt := t.tag()
+ c := High
+ if tt.ScriptID == 0 && !tt.RegionID.IsCountry() {
+ c = Low
+ }
+ if tag, err := tt.Maximize(); err == nil && tag.LangID != 0 {
+ return Base{tag.LangID}, c
+ }
+ return Base{0}, No
+}
+
+// Script infers the script for the language tag. If it was not explicitly given, it will infer
+// a most likely candidate.
+// If more than one script is commonly used for a language, the most likely one
+// is returned with a low confidence indication. For example, it returns (Cyrl, Low)
+// for Serbian.
+// If a script cannot be inferred (Zzzz, No) is returned. We do not use Zyyy (undetermined)
+// as one would suspect from the IANA registry for BCP 47. In a Unicode context Zyyy marks
+// common characters (like 1, 2, 3, '.', etc.) and is therefore more like multiple scripts.
+// See https://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for
+// unknown value in CLDR. (Zzzz, Exact) is returned if Zzzz was explicitly specified.
+// Note that an inferred script is never guaranteed to be the correct one. Latin is
+// almost exclusively used for Afrikaans, but Arabic has been used for some texts
+// in the past. Also, the script that is commonly used may change over time.
+// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
+func (t Tag) Script() (Script, Confidence) {
+ if scr := t.script(); scr != 0 {
+ return Script{scr}, Exact
+ }
+ tt := t.tag()
+ sc, c := language.Script(_Zzzz), No
+ if scr := tt.LangID.SuppressScript(); scr != 0 {
+ // Note: it is not always the case that a language with a suppress
+ // script value is only written in one script (e.g. kk, ms, pa).
+ if tt.RegionID == 0 {
+ return Script{scr}, High
+ }
+ sc, c = scr, High
+ }
+ if tag, err := tt.Maximize(); err == nil {
+ if tag.ScriptID != sc {
+ sc, c = tag.ScriptID, Low
+ }
+ } else {
+ tt, _ = canonicalize(Deprecated|Macro, tt)
+ if tag, err := tt.Maximize(); err == nil && tag.ScriptID != sc {
+ sc, c = tag.ScriptID, Low
+ }
+ }
+ return Script{sc}, c
+}
+
+// Region returns the region for the language tag. If it was not explicitly given, it will
+// infer a most likely candidate from the context.
+// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
+func (t Tag) Region() (Region, Confidence) {
+ if r := t.region(); r != 0 {
+ return Region{r}, Exact
+ }
+ tt := t.tag()
+ if tt, err := tt.Maximize(); err == nil {
+ return Region{tt.RegionID}, Low // TODO: differentiate between high and low.
+ }
+ tt, _ = canonicalize(Deprecated|Macro, tt)
+ if tag, err := tt.Maximize(); err == nil {
+ return Region{tag.RegionID}, Low
+ }
+ return Region{_ZZ}, No // TODO: return world instead of undetermined?
+}
+
+// Variants returns the variants specified explicitly for this language tag.
+// or nil if no variant was specified.
+func (t Tag) Variants() []Variant {
+ if !compact.Tag(t).MayHaveVariants() {
+ return nil
+ }
+ v := []Variant{}
+ x, str := "", t.tag().Variants()
+ for str != "" {
+ x, str = nextToken(str)
+ v = append(v, Variant{x})
+ }
+ return v
+}
+
+// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
+// specific language are substituted with fields from the parent language.
+// The parent for a language may change for newer versions of CLDR.
+//
+// Parent returns a tag for a less specific language that is mutually
+// intelligible or Und if there is no such language. This may not be the same as
+// simply stripping the last BCP 47 subtag. For instance, the parent of "zh-TW"
+// is "zh-Hant", and the parent of "zh-Hant" is "und".
+func (t Tag) Parent() Tag {
+ return Tag(compact.Tag(t).Parent())
+}
+
+// nextToken returns token t and the rest of the string.
+func nextToken(s string) (t, tail string) {
+ p := strings.Index(s[1:], "-")
+ if p == -1 {
+ return s[1:], ""
+ }
+ p++
+ return s[1:p], s[p:]
+}
+
+// Extension is a single BCP 47 extension.
+type Extension struct {
+ s string
+}
+
+// String returns the string representation of the extension, including the
+// type tag.
+func (e Extension) String() string {
+ return e.s
+}
+
+// ParseExtension parses s as an extension and returns it on success.
+func ParseExtension(s string) (e Extension, err error) {
+ ext, err := language.ParseExtension(s)
+ return Extension{ext}, err
+}
+
+// Type returns the one-byte extension type of e. It returns 0 for the zero
+// exception.
+func (e Extension) Type() byte {
+ if e.s == "" {
+ return 0
+ }
+ return e.s[0]
+}
+
+// Tokens returns the list of tokens of e.
+func (e Extension) Tokens() []string {
+ return strings.Split(e.s, "-")
+}
+
+// Extension returns the extension of type x for tag t. It will return
+// false for ok if t does not have the requested extension. The returned
+// extension will be invalid in this case.
+func (t Tag) Extension(x byte) (ext Extension, ok bool) {
+ if !compact.Tag(t).MayHaveExtensions() {
+ return Extension{}, false
+ }
+ e, ok := t.tag().Extension(x)
+ return Extension{e}, ok
+}
+
+// Extensions returns all extensions of t.
+func (t Tag) Extensions() []Extension {
+ if !compact.Tag(t).MayHaveExtensions() {
+ return nil
+ }
+ e := []Extension{}
+ for _, ext := range t.tag().Extensions() {
+ e = append(e, Extension{ext})
+ }
+ return e
+}
+
+// TypeForKey returns the type associated with the given key, where key and type
+// are of the allowed values defined for the Unicode locale extension ('u') in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// TypeForKey will traverse the inheritance chain to get the correct value.
+//
+// If there are multiple types associated with a key, only the first will be
+// returned. If there is no type associated with a key, it returns the empty
+// string.
+func (t Tag) TypeForKey(key string) string {
+ if !compact.Tag(t).MayHaveExtensions() {
+ if key != "rg" && key != "va" {
+ return ""
+ }
+ }
+ return t.tag().TypeForKey(key)
+}
+
+// SetTypeForKey returns a new Tag with the key set to type, where key and type
+// are of the allowed values defined for the Unicode locale extension ('u') in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// An empty value removes an existing pair with the same key.
+func (t Tag) SetTypeForKey(key, value string) (Tag, error) {
+ tt, err := t.tag().SetTypeForKey(key, value)
+ return makeTag(tt), err
+}
+
+// NumCompactTags is the number of compact tags. The maximum tag is
+// NumCompactTags-1.
+const NumCompactTags = compact.NumCompactTags
+
+// CompactIndex returns an index, where 0 <= index < NumCompactTags, for tags
+// for which data exists in the text repository.The index will change over time
+// and should not be stored in persistent storage. If t does not match a compact
+// index, exact will be false and the compact index will be returned for the
+// first match after repeatedly taking the Parent of t.
+func CompactIndex(t Tag) (index int, exact bool) {
+ id, exact := compact.LanguageID(compact.Tag(t))
+ return int(id), exact
+}
+
+var root = language.Tag{}
+
+// Base is an ISO 639 language code, used for encoding the base language
+// of a language tag.
+type Base struct {
+ langID language.Language
+}
+
+// ParseBase parses a 2- or 3-letter ISO 639 code.
+// It returns a ValueError if s is a well-formed but unknown language identifier
+// or another error if another error occurred.
+func ParseBase(s string) (Base, error) {
+ l, err := language.ParseBase(s)
+ return Base{l}, err
+}
+
+// String returns the BCP 47 representation of the base language.
+func (b Base) String() string {
+ return b.langID.String()
+}
+
+// ISO3 returns the ISO 639-3 language code.
+func (b Base) ISO3() string {
+ return b.langID.ISO3()
+}
+
+// IsPrivateUse reports whether this language code is reserved for private use.
+func (b Base) IsPrivateUse() bool {
+ return b.langID.IsPrivateUse()
+}
+
+// Script is a 4-letter ISO 15924 code for representing scripts.
+// It is idiomatically represented in title case.
+type Script struct {
+ scriptID language.Script
+}
+
+// ParseScript parses a 4-letter ISO 15924 code.
+// It returns a ValueError if s is a well-formed but unknown script identifier
+// or another error if another error occurred.
+func ParseScript(s string) (Script, error) {
+ sc, err := language.ParseScript(s)
+ return Script{sc}, err
+}
+
+// String returns the script code in title case.
+// It returns "Zzzz" for an unspecified script.
+func (s Script) String() string {
+ return s.scriptID.String()
+}
+
+// IsPrivateUse reports whether this script code is reserved for private use.
+func (s Script) IsPrivateUse() bool {
+ return s.scriptID.IsPrivateUse()
+}
+
+// Region is an ISO 3166-1 or UN M.49 code for representing countries and regions.
+type Region struct {
+ regionID language.Region
+}
+
+// EncodeM49 returns the Region for the given UN M.49 code.
+// It returns an error if r is not a valid code.
+func EncodeM49(r int) (Region, error) {
+ rid, err := language.EncodeM49(r)
+ return Region{rid}, err
+}
+
+// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code.
+// It returns a ValueError if s is a well-formed but unknown region identifier
+// or another error if another error occurred.
+func ParseRegion(s string) (Region, error) {
+ r, err := language.ParseRegion(s)
+ return Region{r}, err
+}
+
+// String returns the BCP 47 representation for the region.
+// It returns "ZZ" for an unspecified region.
+func (r Region) String() string {
+ return r.regionID.String()
+}
+
+// ISO3 returns the 3-letter ISO code of r.
+// Note that not all regions have a 3-letter ISO code.
+// In such cases this method returns "ZZZ".
+func (r Region) ISO3() string {
+ return r.regionID.ISO3()
+}
+
+// M49 returns the UN M.49 encoding of r, or 0 if this encoding
+// is not defined for r.
+func (r Region) M49() int {
+ return r.regionID.M49()
+}
+
+// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This
+// may include private-use tags that are assigned by CLDR and used in this
+// implementation. So IsPrivateUse and IsCountry can be simultaneously true.
+func (r Region) IsPrivateUse() bool {
+ return r.regionID.IsPrivateUse()
+}
+
+// IsCountry returns whether this region is a country or autonomous area. This
+// includes non-standard definitions from CLDR.
+func (r Region) IsCountry() bool {
+ return r.regionID.IsCountry()
+}
+
+// IsGroup returns whether this region defines a collection of regions. This
+// includes non-standard definitions from CLDR.
+func (r Region) IsGroup() bool {
+ return r.regionID.IsGroup()
+}
+
+// Contains returns whether Region c is contained by Region r. It returns true
+// if c == r.
+func (r Region) Contains(c Region) bool {
+ return r.regionID.Contains(c.regionID)
+}
+
+// TLD returns the country code top-level domain (ccTLD). UK is returned for GB.
+// In all other cases it returns either the region itself or an error.
+//
+// This method may return an error for a region for which there exists a
+// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The
+// region will already be canonicalized it was obtained from a Tag that was
+// obtained using any of the default methods.
+func (r Region) TLD() (Region, error) {
+ tld, err := r.regionID.TLD()
+ return Region{tld}, err
+}
+
+// Canonicalize returns the region or a possible replacement if the region is
+// deprecated. It will not return a replacement for deprecated regions that
+// are split into multiple regions.
+func (r Region) Canonicalize() Region {
+ return Region{r.regionID.Canonicalize()}
+}
+
+// Variant represents a registered variant of a language as defined by BCP 47.
+type Variant struct {
+ variant string
+}
+
+// ParseVariant parses and returns a Variant. An error is returned if s is not
+// a valid variant.
+func ParseVariant(s string) (Variant, error) {
+ v, err := language.ParseVariant(s)
+ return Variant{v.String()}, err
+}
+
+// String returns the string representation of the variant.
+func (v Variant) String() string {
+ return v.variant
+}
diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go
@@ -0,0 +1,735 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+ "errors"
+ "strings"
+
+ "golang.org/x/text/internal/language"
+)
+
+// A MatchOption configures a Matcher.
+type MatchOption func(*matcher)
+
+// PreferSameScript will, in the absence of a match, result in the first
+// preferred tag with the same script as a supported tag to match this supported
+// tag. The default is currently true, but this may change in the future.
+func PreferSameScript(preferSame bool) MatchOption {
+ return func(m *matcher) { m.preferSameScript = preferSame }
+}
+
+// TODO(v1.0.0): consider making Matcher a concrete type, instead of interface.
+// There doesn't seem to be too much need for multiple types.
+// Making it a concrete type allows MatchStrings to be a method, which will
+// improve its discoverability.
+
+// MatchStrings parses and matches the given strings until one of them matches
+// the language in the Matcher. A string may be an Accept-Language header as
+// handled by ParseAcceptLanguage. The default language is returned if no
+// other language matched.
+func MatchStrings(m Matcher, lang ...string) (tag Tag, index int) {
+ for _, accept := range lang {
+ desired, _, err := ParseAcceptLanguage(accept)
+ if err != nil {
+ continue
+ }
+ if tag, index, conf := m.Match(desired...); conf != No {
+ return tag, index
+ }
+ }
+ tag, index, _ = m.Match()
+ return
+}
+
+// Matcher is the interface that wraps the Match method.
+//
+// Match returns the best match for any of the given tags, along with
+// a unique index associated with the returned tag and a confidence
+// score.
+type Matcher interface {
+ Match(t ...Tag) (tag Tag, index int, c Confidence)
+}
+
+// Comprehends reports the confidence score for a speaker of a given language
+// to being able to comprehend the written form of an alternative language.
+func Comprehends(speaker, alternative Tag) Confidence {
+ _, _, c := NewMatcher([]Tag{alternative}).Match(speaker)
+ return c
+}
+
+// NewMatcher returns a Matcher that matches an ordered list of preferred tags
+// against a list of supported tags based on written intelligibility, closeness
+// of dialect, equivalence of subtags and various other rules. It is initialized
+// with the list of supported tags. The first element is used as the default
+// value in case no match is found.
+//
+// Its Match method matches the first of the given Tags to reach a certain
+// confidence threshold. The tags passed to Match should therefore be specified
+// in order of preference. Extensions are ignored for matching.
+//
+// The index returned by the Match method corresponds to the index of the
+// matched tag in t, but is augmented with the Unicode extension ('u')of the
+// corresponding preferred tag. This allows user locale options to be passed
+// transparently.
+func NewMatcher(t []Tag, options ...MatchOption) Matcher {
+ return newMatcher(t, options)
+}
+
+func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) {
+ var tt language.Tag
+ match, w, c := m.getBest(want...)
+ if match != nil {
+ tt, index = match.tag, match.index
+ } else {
+ // TODO: this should be an option
+ tt = m.default_.tag
+ if m.preferSameScript {
+ outer:
+ for _, w := range want {
+ script, _ := w.Script()
+ if script.scriptID == 0 {
+ // Don't do anything if there is no script, such as with
+ // private subtags.
+ continue
+ }
+ for i, h := range m.supported {
+ if script.scriptID == h.maxScript {
+ tt, index = h.tag, i
+ break outer
+ }
+ }
+ }
+ }
+ // TODO: select first language tag based on script.
+ }
+ if w.RegionID != tt.RegionID && w.RegionID != 0 {
+ if w.RegionID != 0 && tt.RegionID != 0 && tt.RegionID.Contains(w.RegionID) {
+ tt.RegionID = w.RegionID
+ tt.RemakeString()
+ } else if r := w.RegionID.String(); len(r) == 2 {
+ // TODO: also filter macro and deprecated.
+ tt, _ = tt.SetTypeForKey("rg", strings.ToLower(r)+"zzzz")
+ }
+ }
+ // Copy options from the user-provided tag into the result tag. This is hard
+ // to do after the fact, so we do it here.
+ // TODO: add in alternative variants to -u-va-.
+ // TODO: add preferred region to -u-rg-.
+ if e := w.Extensions(); len(e) > 0 {
+ b := language.Builder{}
+ b.SetTag(tt)
+ for _, e := range e {
+ b.AddExt(e)
+ }
+ tt = b.Make()
+ }
+ return makeTag(tt), index, c
+}
+
+// ErrMissingLikelyTagsData indicates no information was available
+// to compute likely values of missing tags.
+var ErrMissingLikelyTagsData = errors.New("missing likely tags data")
+
+// func (t *Tag) setTagsFrom(id Tag) {
+// t.LangID = id.LangID
+// t.ScriptID = id.ScriptID
+// t.RegionID = id.RegionID
+// }
+
+// Tag Matching
+// CLDR defines an algorithm for finding the best match between two sets of language
+// tags. The basic algorithm defines how to score a possible match and then find
+// the match with the best score
+// (see https://www.unicode.org/reports/tr35/#LanguageMatching).
+// Using scoring has several disadvantages. The scoring obfuscates the importance of
+// the various factors considered, making the algorithm harder to understand. Using
+// scoring also requires the full score to be computed for each pair of tags.
+//
+// We will use a different algorithm which aims to have the following properties:
+// - clarity on the precedence of the various selection factors, and
+// - improved performance by allowing early termination of a comparison.
+//
+// Matching algorithm (overview)
+// Input:
+// - supported: a set of supported tags
+// - default: the default tag to return in case there is no match
+// - desired: list of desired tags, ordered by preference, starting with
+// the most-preferred.
+//
+// Algorithm:
+// 1) Set the best match to the lowest confidence level
+// 2) For each tag in "desired":
+// a) For each tag in "supported":
+// 1) compute the match between the two tags.
+// 2) if the match is better than the previous best match, replace it
+// with the new match. (see next section)
+// b) if the current best match is Exact and pin is true the result will be
+// frozen to the language found thusfar, although better matches may
+// still be found for the same language.
+// 3) If the best match so far is below a certain threshold, return "default".
+//
+// Ranking:
+// We use two phases to determine whether one pair of tags are a better match
+// than another pair of tags. First, we determine a rough confidence level. If the
+// levels are different, the one with the highest confidence wins.
+// Second, if the rough confidence levels are identical, we use a set of tie-breaker
+// rules.
+//
+// The confidence level of matching a pair of tags is determined by finding the
+// lowest confidence level of any matches of the corresponding subtags (the
+// result is deemed as good as its weakest link).
+// We define the following levels:
+// Exact - An exact match of a subtag, before adding likely subtags.
+// MaxExact - An exact match of a subtag, after adding likely subtags.
+// [See Note 2].
+// High - High level of mutual intelligibility between different subtag
+// variants.
+// Low - Low level of mutual intelligibility between different subtag
+// variants.
+// No - No mutual intelligibility.
+//
+// The following levels can occur for each type of subtag:
+// Base: Exact, MaxExact, High, Low, No
+// Script: Exact, MaxExact [see Note 3], Low, No
+// Region: Exact, MaxExact, High
+// Variant: Exact, High
+// Private: Exact, No
+//
+// Any result with a confidence level of Low or higher is deemed a possible match.
+// Once a desired tag matches any of the supported tags with a level of MaxExact
+// or higher, the next desired tag is not considered (see Step 2.b).
+// Note that CLDR provides languageMatching data that defines close equivalence
+// classes for base languages, scripts and regions.
+//
+// Tie-breaking
+// If we get the same confidence level for two matches, we apply a sequence of
+// tie-breaking rules. The first that succeeds defines the result. The rules are
+// applied in the following order.
+// 1) Original language was defined and was identical.
+// 2) Original region was defined and was identical.
+// 3) Distance between two maximized regions was the smallest.
+// 4) Original script was defined and was identical.
+// 5) Distance from want tag to have tag using the parent relation [see Note 5.]
+// If there is still no winner after these rules are applied, the first match
+// found wins.
+//
+// Notes:
+// [2] In practice, as matching of Exact is done in a separate phase from
+// matching the other levels, we reuse the Exact level to mean MaxExact in
+// the second phase. As a consequence, we only need the levels defined by
+// the Confidence type. The MaxExact confidence level is mapped to High in
+// the public API.
+// [3] We do not differentiate between maximized script values that were derived
+// from suppressScript versus most likely tag data. We determined that in
+// ranking the two, one ranks just after the other. Moreover, the two cannot
+// occur concurrently. As a consequence, they are identical for practical
+// purposes.
+// [4] In case of deprecated, macro-equivalents and legacy mappings, we assign
+// the MaxExact level to allow iw vs he to still be a closer match than
+// en-AU vs en-US, for example.
+// [5] In CLDR a locale inherits fields that are unspecified for this locale
+// from its parent. Therefore, if a locale is a parent of another locale,
+// it is a strong measure for closeness, especially when no other tie
+// breaker rule applies. One could also argue it is inconsistent, for
+// example, when pt-AO matches pt (which CLDR equates with pt-BR), even
+// though its parent is pt-PT according to the inheritance rules.
+//
+// Implementation Details:
+// There are several performance considerations worth pointing out. Most notably,
+// we preprocess as much as possible (within reason) at the time of creation of a
+// matcher. This includes:
+// - creating a per-language map, which includes data for the raw base language
+// and its canonicalized variant (if applicable),
+// - expanding entries for the equivalence classes defined in CLDR's
+// languageMatch data.
+// The per-language map ensures that typically only a very small number of tags
+// need to be considered. The pre-expansion of canonicalized subtags and
+// equivalence classes reduces the amount of map lookups that need to be done at
+// runtime.
+
+// matcher keeps a set of supported language tags, indexed by language.
+type matcher struct {
+ default_ *haveTag
+ supported []*haveTag
+ index map[language.Language]*matchHeader
+ passSettings bool
+ preferSameScript bool
+}
+
+// matchHeader has the lists of tags for exact matches and matches based on
+// maximized and canonicalized tags for a given language.
+type matchHeader struct {
+ haveTags []*haveTag
+ original bool
+}
+
+// haveTag holds a supported Tag and its maximized script and region. The maximized
+// or canonicalized language is not stored as it is not needed during matching.
+type haveTag struct {
+ tag language.Tag
+
+ // index of this tag in the original list of supported tags.
+ index int
+
+ // conf is the maximum confidence that can result from matching this haveTag.
+ // When conf < Exact this means it was inserted after applying a CLDR equivalence rule.
+ conf Confidence
+
+ // Maximized region and script.
+ maxRegion language.Region
+ maxScript language.Script
+
+ // altScript may be checked as an alternative match to maxScript. If altScript
+ // matches, the confidence level for this match is Low. Theoretically there
+ // could be multiple alternative scripts. This does not occur in practice.
+ altScript language.Script
+
+ // nextMax is the index of the next haveTag with the same maximized tags.
+ nextMax uint16
+}
+
+func makeHaveTag(tag language.Tag, index int) (haveTag, language.Language) {
+ max := tag
+ if tag.LangID != 0 || tag.RegionID != 0 || tag.ScriptID != 0 {
+ max, _ = canonicalize(All, max)
+ max, _ = max.Maximize()
+ max.RemakeString()
+ }
+ return haveTag{tag, index, Exact, max.RegionID, max.ScriptID, altScript(max.LangID, max.ScriptID), 0}, max.LangID
+}
+
+// altScript returns an alternative script that may match the given script with
+// a low confidence. At the moment, the langMatch data allows for at most one
+// script to map to another and we rely on this to keep the code simple.
+func altScript(l language.Language, s language.Script) language.Script {
+ for _, alt := range matchScript {
+ // TODO: also match cases where language is not the same.
+ if (language.Language(alt.wantLang) == l || language.Language(alt.haveLang) == l) &&
+ language.Script(alt.haveScript) == s {
+ return language.Script(alt.wantScript)
+ }
+ }
+ return 0
+}
+
+// addIfNew adds a haveTag to the list of tags only if it is a unique tag.
+// Tags that have the same maximized values are linked by index.
+func (h *matchHeader) addIfNew(n haveTag, exact bool) {
+ h.original = h.original || exact
+ // Don't add new exact matches.
+ for _, v := range h.haveTags {
+ if equalsRest(v.tag, n.tag) {
+ return
+ }
+ }
+ // Allow duplicate maximized tags, but create a linked list to allow quickly
+ // comparing the equivalents and bail out.
+ for i, v := range h.haveTags {
+ if v.maxScript == n.maxScript &&
+ v.maxRegion == n.maxRegion &&
+ v.tag.VariantOrPrivateUseTags() == n.tag.VariantOrPrivateUseTags() {
+ for h.haveTags[i].nextMax != 0 {
+ i = int(h.haveTags[i].nextMax)
+ }
+ h.haveTags[i].nextMax = uint16(len(h.haveTags))
+ break
+ }
+ }
+ h.haveTags = append(h.haveTags, &n)
+}
+
+// header returns the matchHeader for the given language. It creates one if
+// it doesn't already exist.
+func (m *matcher) header(l language.Language) *matchHeader {
+ if h := m.index[l]; h != nil {
+ return h
+ }
+ h := &matchHeader{}
+ m.index[l] = h
+ return h
+}
+
+func toConf(d uint8) Confidence {
+ if d <= 10 {
+ return High
+ }
+ if d < 30 {
+ return Low
+ }
+ return No
+}
+
+// newMatcher builds an index for the given supported tags and returns it as
+// a matcher. It also expands the index by considering various equivalence classes
+// for a given tag.
+func newMatcher(supported []Tag, options []MatchOption) *matcher {
+ m := &matcher{
+ index: make(map[language.Language]*matchHeader),
+ preferSameScript: true,
+ }
+ for _, o := range options {
+ o(m)
+ }
+ if len(supported) == 0 {
+ m.default_ = &haveTag{}
+ return m
+ }
+ // Add supported languages to the index. Add exact matches first to give
+ // them precedence.
+ for i, tag := range supported {
+ tt := tag.tag()
+ pair, _ := makeHaveTag(tt, i)
+ m.header(tt.LangID).addIfNew(pair, true)
+ m.supported = append(m.supported, &pair)
+ }
+ m.default_ = m.header(supported[0].lang()).haveTags[0]
+ // Keep these in two different loops to support the case that two equivalent
+ // languages are distinguished, such as iw and he.
+ for i, tag := range supported {
+ tt := tag.tag()
+ pair, max := makeHaveTag(tt, i)
+ if max != tt.LangID {
+ m.header(max).addIfNew(pair, true)
+ }
+ }
+
+ // update is used to add indexes in the map for equivalent languages.
+ // update will only add entries to original indexes, thus not computing any
+ // transitive relations.
+ update := func(want, have uint16, conf Confidence) {
+ if hh := m.index[language.Language(have)]; hh != nil {
+ if !hh.original {
+ return
+ }
+ hw := m.header(language.Language(want))
+ for _, ht := range hh.haveTags {
+ v := *ht
+ if conf < v.conf {
+ v.conf = conf
+ }
+ v.nextMax = 0 // this value needs to be recomputed
+ if v.altScript != 0 {
+ v.altScript = altScript(language.Language(want), v.maxScript)
+ }
+ hw.addIfNew(v, conf == Exact && hh.original)
+ }
+ }
+ }
+
+ // Add entries for languages with mutual intelligibility as defined by CLDR's
+ // languageMatch data.
+ for _, ml := range matchLang {
+ update(ml.want, ml.have, toConf(ml.distance))
+ if !ml.oneway {
+ update(ml.have, ml.want, toConf(ml.distance))
+ }
+ }
+
+ // Add entries for possible canonicalizations. This is an optimization to
+ // ensure that only one map lookup needs to be done at runtime per desired tag.
+ // First we match deprecated equivalents. If they are perfect equivalents
+ // (their canonicalization simply substitutes a different language code, but
+ // nothing else), the match confidence is Exact, otherwise it is High.
+ for i, lm := range language.AliasMap {
+ // If deprecated codes match and there is no fiddling with the script
+ // or region, we consider it an exact match.
+ conf := Exact
+ if language.AliasTypes[i] != language.Macro {
+ if !isExactEquivalent(language.Language(lm.From)) {
+ conf = High
+ }
+ update(lm.To, lm.From, conf)
+ }
+ update(lm.From, lm.To, conf)
+ }
+ return m
+}
+
+// getBest gets the best matching tag in m for any of the given tags, taking into
+// account the order of preference of the given tags.
+func (m *matcher) getBest(want ...Tag) (got *haveTag, orig language.Tag, c Confidence) {
+ best := bestMatch{}
+ for i, ww := range want {
+ w := ww.tag()
+ var max language.Tag
+ // Check for exact match first.
+ h := m.index[w.LangID]
+ if w.LangID != 0 {
+ if h == nil {
+ continue
+ }
+ // Base language is defined.
+ max, _ = canonicalize(Legacy|Deprecated|Macro, w)
+ // A region that is added through canonicalization is stronger than
+ // a maximized region: set it in the original (e.g. mo -> ro-MD).
+ if w.RegionID != max.RegionID {
+ w.RegionID = max.RegionID
+ }
+ // TODO: should we do the same for scripts?
+ // See test case: en, sr, nl ; sh ; sr
+ max, _ = max.Maximize()
+ } else {
+ // Base language is not defined.
+ if h != nil {
+ for i := range h.haveTags {
+ have := h.haveTags[i]
+ if equalsRest(have.tag, w) {
+ return have, w, Exact
+ }
+ }
+ }
+ if w.ScriptID == 0 && w.RegionID == 0 {
+ // We skip all tags matching und for approximate matching, including
+ // private tags.
+ continue
+ }
+ max, _ = w.Maximize()
+ if h = m.index[max.LangID]; h == nil {
+ continue
+ }
+ }
+ pin := true
+ for _, t := range want[i+1:] {
+ if w.LangID == t.lang() {
+ pin = false
+ break
+ }
+ }
+ // Check for match based on maximized tag.
+ for i := range h.haveTags {
+ have := h.haveTags[i]
+ best.update(have, w, max.ScriptID, max.RegionID, pin)
+ if best.conf == Exact {
+ for have.nextMax != 0 {
+ have = h.haveTags[have.nextMax]
+ best.update(have, w, max.ScriptID, max.RegionID, pin)
+ }
+ return best.have, best.want, best.conf
+ }
+ }
+ }
+ if best.conf <= No {
+ if len(want) != 0 {
+ return nil, want[0].tag(), No
+ }
+ return nil, language.Tag{}, No
+ }
+ return best.have, best.want, best.conf
+}
+
+// bestMatch accumulates the best match so far.
+type bestMatch struct {
+ have *haveTag
+ want language.Tag
+ conf Confidence
+ pinnedRegion language.Region
+ pinLanguage bool
+ sameRegionGroup bool
+ // Cached results from applying tie-breaking rules.
+ origLang bool
+ origReg bool
+ paradigmReg bool
+ regGroupDist uint8
+ origScript bool
+}
+
+// update updates the existing best match if the new pair is considered to be a
+// better match. To determine if the given pair is a better match, it first
+// computes the rough confidence level. If this surpasses the current match, it
+// will replace it and update the tie-breaker rule cache. If there is a tie, it
+// proceeds with applying a series of tie-breaker rules. If there is no
+// conclusive winner after applying the tie-breaker rules, it leaves the current
+// match as the preferred match.
+//
+// If pin is true and have and tag are a strong match, it will henceforth only
+// consider matches for this language. This corresponds to the idea that most
+// users have a strong preference for the first defined language. A user can
+// still prefer a second language over a dialect of the preferred language by
+// explicitly specifying dialects, e.g. "en, nl, en-GB". In this case pin should
+// be false.
+func (m *bestMatch) update(have *haveTag, tag language.Tag, maxScript language.Script, maxRegion language.Region, pin bool) {
+ // Bail if the maximum attainable confidence is below that of the current best match.
+ c := have.conf
+ if c < m.conf {
+ return
+ }
+ // Don't change the language once we already have found an exact match.
+ if m.pinLanguage && tag.LangID != m.want.LangID {
+ return
+ }
+ // Pin the region group if we are comparing tags for the same language.
+ if tag.LangID == m.want.LangID && m.sameRegionGroup {
+ _, sameGroup := regionGroupDist(m.pinnedRegion, have.maxRegion, have.maxScript, m.want.LangID)
+ if !sameGroup {
+ return
+ }
+ }
+ if c == Exact && have.maxScript == maxScript {
+ // If there is another language and then another entry of this language,
+ // don't pin anything, otherwise pin the language.
+ m.pinLanguage = pin
+ }
+ if equalsRest(have.tag, tag) {
+ } else if have.maxScript != maxScript {
+ // There is usually very little comprehension between different scripts.
+ // In a few cases there may still be Low comprehension. This possibility
+ // is pre-computed and stored in have.altScript.
+ if Low < m.conf || have.altScript != maxScript {
+ return
+ }
+ c = Low
+ } else if have.maxRegion != maxRegion {
+ if High < c {
+ // There is usually a small difference between languages across regions.
+ c = High
+ }
+ }
+
+ // We store the results of the computations of the tie-breaker rules along
+ // with the best match. There is no need to do the checks once we determine
+ // we have a winner, but we do still need to do the tie-breaker computations.
+ // We use "beaten" to keep track if we still need to do the checks.
+ beaten := false // true if the new pair defeats the current one.
+ if c != m.conf {
+ if c < m.conf {
+ return
+ }
+ beaten = true
+ }
+
+ // Tie-breaker rules:
+ // We prefer if the pre-maximized language was specified and identical.
+ origLang := have.tag.LangID == tag.LangID && tag.LangID != 0
+ if !beaten && m.origLang != origLang {
+ if m.origLang {
+ return
+ }
+ beaten = true
+ }
+
+ // We prefer if the pre-maximized region was specified and identical.
+ origReg := have.tag.RegionID == tag.RegionID && tag.RegionID != 0
+ if !beaten && m.origReg != origReg {
+ if m.origReg {
+ return
+ }
+ beaten = true
+ }
+
+ regGroupDist, sameGroup := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.LangID)
+ if !beaten && m.regGroupDist != regGroupDist {
+ if regGroupDist > m.regGroupDist {
+ return
+ }
+ beaten = true
+ }
+
+ paradigmReg := isParadigmLocale(tag.LangID, have.maxRegion)
+ if !beaten && m.paradigmReg != paradigmReg {
+ if !paradigmReg {
+ return
+ }
+ beaten = true
+ }
+
+ // Next we prefer if the pre-maximized script was specified and identical.
+ origScript := have.tag.ScriptID == tag.ScriptID && tag.ScriptID != 0
+ if !beaten && m.origScript != origScript {
+ if m.origScript {
+ return
+ }
+ beaten = true
+ }
+
+ // Update m to the newly found best match.
+ if beaten {
+ m.have = have
+ m.want = tag
+ m.conf = c
+ m.pinnedRegion = maxRegion
+ m.sameRegionGroup = sameGroup
+ m.origLang = origLang
+ m.origReg = origReg
+ m.paradigmReg = paradigmReg
+ m.origScript = origScript
+ m.regGroupDist = regGroupDist
+ }
+}
+
+func isParadigmLocale(lang language.Language, r language.Region) bool {
+ for _, e := range paradigmLocales {
+ if language.Language(e[0]) == lang && (r == language.Region(e[1]) || r == language.Region(e[2])) {
+ return true
+ }
+ }
+ return false
+}
+
+// regionGroupDist computes the distance between two regions based on their
+// CLDR grouping.
+func regionGroupDist(a, b language.Region, script language.Script, lang language.Language) (dist uint8, same bool) {
+ const defaultDistance = 4
+
+ aGroup := uint(regionToGroups[a]) << 1
+ bGroup := uint(regionToGroups[b]) << 1
+ for _, ri := range matchRegion {
+ if language.Language(ri.lang) == lang && (ri.script == 0 || language.Script(ri.script) == script) {
+ group := uint(1 << (ri.group &^ 0x80))
+ if 0x80&ri.group == 0 {
+ if aGroup&bGroup&group != 0 { // Both regions are in the group.
+ return ri.distance, ri.distance == defaultDistance
+ }
+ } else {
+ if (aGroup|bGroup)&group == 0 { // Both regions are not in the group.
+ return ri.distance, ri.distance == defaultDistance
+ }
+ }
+ }
+ }
+ return defaultDistance, true
+}
+
+// equalsRest compares everything except the language.
+func equalsRest(a, b language.Tag) bool {
+ // TODO: don't include extensions in this comparison. To do this efficiently,
+ // though, we should handle private tags separately.
+ return a.ScriptID == b.ScriptID && a.RegionID == b.RegionID && a.VariantOrPrivateUseTags() == b.VariantOrPrivateUseTags()
+}
+
+// isExactEquivalent returns true if canonicalizing the language will not alter
+// the script or region of a tag.
+func isExactEquivalent(l language.Language) bool {
+ for _, o := range notEquivalent {
+ if o == l {
+ return false
+ }
+ }
+ return true
+}
+
+var notEquivalent []language.Language
+
+func init() {
+ // Create a list of all languages for which canonicalization may alter the
+ // script or region.
+ for _, lm := range language.AliasMap {
+ tag := language.Tag{LangID: language.Language(lm.From)}
+ if tag, _ = canonicalize(All, tag); tag.ScriptID != 0 || tag.RegionID != 0 {
+ notEquivalent = append(notEquivalent, language.Language(lm.From))
+ }
+ }
+ // Maximize undefined regions of paradigm locales.
+ for i, v := range paradigmLocales {
+ t := language.Tag{LangID: language.Language(v[0])}
+ max, _ := t.Maximize()
+ if v[1] == 0 {
+ paradigmLocales[i][1] = uint16(max.RegionID)
+ }
+ if v[2] == 0 {
+ paradigmLocales[i][2] = uint16(max.RegionID)
+ }
+ }
+}
diff --git a/vendor/golang.org/x/text/language/parse.go b/vendor/golang.org/x/text/language/parse.go
@@ -0,0 +1,256 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+ "errors"
+ "sort"
+ "strconv"
+ "strings"
+
+ "golang.org/x/text/internal/language"
+)
+
+// ValueError is returned by any of the parsing functions when the
+// input is well-formed but the respective subtag is not recognized
+// as a valid value.
+type ValueError interface {
+ error
+
+ // Subtag returns the subtag for which the error occurred.
+ Subtag() string
+}
+
+// Parse parses the given BCP 47 string and returns a valid Tag. If parsing
+// failed it returns an error and any part of the tag that could be parsed.
+// If parsing succeeded but an unknown value was found, it returns
+// ValueError. The Tag returned in this case is just stripped of the unknown
+// value. All other values are preserved. It accepts tags in the BCP 47 format
+// and extensions to this standard defined in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// The resulting tag is canonicalized using the default canonicalization type.
+func Parse(s string) (t Tag, err error) {
+ return Default.Parse(s)
+}
+
+// Parse parses the given BCP 47 string and returns a valid Tag. If parsing
+// failed it returns an error and any part of the tag that could be parsed.
+// If parsing succeeded but an unknown value was found, it returns
+// ValueError. The Tag returned in this case is just stripped of the unknown
+// value. All other values are preserved. It accepts tags in the BCP 47 format
+// and extensions to this standard defined in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// The resulting tag is canonicalized using the canonicalization type c.
+func (c CanonType) Parse(s string) (t Tag, err error) {
+ defer func() {
+ if recover() != nil {
+ t = Tag{}
+ err = language.ErrSyntax
+ }
+ }()
+
+ tt, err := language.Parse(s)
+ if err != nil {
+ return makeTag(tt), err
+ }
+ tt, changed := canonicalize(c, tt)
+ if changed {
+ tt.RemakeString()
+ }
+ return makeTag(tt), nil
+}
+
+// Compose creates a Tag from individual parts, which may be of type Tag, Base,
+// Script, Region, Variant, []Variant, Extension, []Extension or error. If a
+// Base, Script or Region or slice of type Variant or Extension is passed more
+// than once, the latter will overwrite the former. Variants and Extensions are
+// accumulated, but if two extensions of the same type are passed, the latter
+// will replace the former. For -u extensions, though, the key-type pairs are
+// added, where later values overwrite older ones. A Tag overwrites all former
+// values and typically only makes sense as the first argument. The resulting
+// tag is returned after canonicalizing using the Default CanonType. If one or
+// more errors are encountered, one of the errors is returned.
+func Compose(part ...interface{}) (t Tag, err error) {
+ return Default.Compose(part...)
+}
+
+// Compose creates a Tag from individual parts, which may be of type Tag, Base,
+// Script, Region, Variant, []Variant, Extension, []Extension or error. If a
+// Base, Script or Region or slice of type Variant or Extension is passed more
+// than once, the latter will overwrite the former. Variants and Extensions are
+// accumulated, but if two extensions of the same type are passed, the latter
+// will replace the former. For -u extensions, though, the key-type pairs are
+// added, where later values overwrite older ones. A Tag overwrites all former
+// values and typically only makes sense as the first argument. The resulting
+// tag is returned after canonicalizing using CanonType c. If one or more errors
+// are encountered, one of the errors is returned.
+func (c CanonType) Compose(part ...interface{}) (t Tag, err error) {
+ defer func() {
+ if recover() != nil {
+ t = Tag{}
+ err = language.ErrSyntax
+ }
+ }()
+
+ var b language.Builder
+ if err = update(&b, part...); err != nil {
+ return und, err
+ }
+ b.Tag, _ = canonicalize(c, b.Tag)
+ return makeTag(b.Make()), err
+}
+
+var errInvalidArgument = errors.New("invalid Extension or Variant")
+
+func update(b *language.Builder, part ...interface{}) (err error) {
+ for _, x := range part {
+ switch v := x.(type) {
+ case Tag:
+ b.SetTag(v.tag())
+ case Base:
+ b.Tag.LangID = v.langID
+ case Script:
+ b.Tag.ScriptID = v.scriptID
+ case Region:
+ b.Tag.RegionID = v.regionID
+ case Variant:
+ if v.variant == "" {
+ err = errInvalidArgument
+ break
+ }
+ b.AddVariant(v.variant)
+ case Extension:
+ if v.s == "" {
+ err = errInvalidArgument
+ break
+ }
+ b.SetExt(v.s)
+ case []Variant:
+ b.ClearVariants()
+ for _, v := range v {
+ b.AddVariant(v.variant)
+ }
+ case []Extension:
+ b.ClearExtensions()
+ for _, e := range v {
+ b.SetExt(e.s)
+ }
+ // TODO: support parsing of raw strings based on morphology or just extensions?
+ case error:
+ if v != nil {
+ err = v
+ }
+ }
+ }
+ return
+}
+
+var errInvalidWeight = errors.New("ParseAcceptLanguage: invalid weight")
+var errTagListTooLarge = errors.New("tag list exceeds max length")
+
+// ParseAcceptLanguage parses the contents of an Accept-Language header as
+// defined in http://www.ietf.org/rfc/rfc2616.txt and returns a list of Tags and
+// a list of corresponding quality weights. It is more permissive than RFC 2616
+// and may return non-nil slices even if the input is not valid.
+// The Tags will be sorted by highest weight first and then by first occurrence.
+// Tags with a weight of zero will be dropped. An error will be returned if the
+// input could not be parsed.
+func ParseAcceptLanguage(s string) (tag []Tag, q []float32, err error) {
+ defer func() {
+ if recover() != nil {
+ tag = nil
+ q = nil
+ err = language.ErrSyntax
+ }
+ }()
+
+ if strings.Count(s, "-") > 1000 {
+ return nil, nil, errTagListTooLarge
+ }
+
+ var entry string
+ for s != "" {
+ if entry, s = split(s, ','); entry == "" {
+ continue
+ }
+
+ entry, weight := split(entry, ';')
+
+ // Scan the language.
+ t, err := Parse(entry)
+ if err != nil {
+ id, ok := acceptFallback[entry]
+ if !ok {
+ return nil, nil, err
+ }
+ t = makeTag(language.Tag{LangID: id})
+ }
+
+ // Scan the optional weight.
+ w := 1.0
+ if weight != "" {
+ weight = consume(weight, 'q')
+ weight = consume(weight, '=')
+ // consume returns the empty string when a token could not be
+ // consumed, resulting in an error for ParseFloat.
+ if w, err = strconv.ParseFloat(weight, 32); err != nil {
+ return nil, nil, errInvalidWeight
+ }
+ // Drop tags with a quality weight of 0.
+ if w <= 0 {
+ continue
+ }
+ }
+
+ tag = append(tag, t)
+ q = append(q, float32(w))
+ }
+ sort.Stable(&tagSort{tag, q})
+ return tag, q, nil
+}
+
+// consume removes a leading token c from s and returns the result or the empty
+// string if there is no such token.
+func consume(s string, c byte) string {
+ if s == "" || s[0] != c {
+ return ""
+ }
+ return strings.TrimSpace(s[1:])
+}
+
+func split(s string, c byte) (head, tail string) {
+ if i := strings.IndexByte(s, c); i >= 0 {
+ return strings.TrimSpace(s[:i]), strings.TrimSpace(s[i+1:])
+ }
+ return strings.TrimSpace(s), ""
+}
+
+// Add hack mapping to deal with a small number of cases that occur
+// in Accept-Language (with reasonable frequency).
+var acceptFallback = map[string]language.Language{
+ "english": _en,
+ "deutsch": _de,
+ "italian": _it,
+ "french": _fr,
+ "*": _mul, // defined in the spec to match all languages.
+}
+
+type tagSort struct {
+ tag []Tag
+ q []float32
+}
+
+func (s *tagSort) Len() int {
+ return len(s.q)
+}
+
+func (s *tagSort) Less(i, j int) bool {
+ return s.q[i] > s.q[j]
+}
+
+func (s *tagSort) Swap(i, j int) {
+ s.tag[i], s.tag[j] = s.tag[j], s.tag[i]
+ s.q[i], s.q[j] = s.q[j], s.q[i]
+}
diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go
@@ -0,0 +1,298 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package language
+
+// CLDRVersion is the CLDR version from which the tables in this package are derived.
+const CLDRVersion = "32"
+
+const (
+ _de = 269
+ _en = 313
+ _fr = 350
+ _it = 505
+ _mo = 784
+ _no = 879
+ _nb = 839
+ _pt = 960
+ _sh = 1031
+ _mul = 806
+ _und = 0
+)
+const (
+ _001 = 1
+ _419 = 31
+ _BR = 65
+ _CA = 73
+ _ES = 111
+ _GB = 124
+ _MD = 189
+ _PT = 239
+ _UK = 307
+ _US = 310
+ _ZZ = 358
+ _XA = 324
+ _XC = 326
+ _XK = 334
+)
+const (
+ _Latn = 91
+ _Hani = 57
+ _Hans = 59
+ _Hant = 60
+ _Qaaa = 149
+ _Qaai = 157
+ _Qabx = 198
+ _Zinh = 255
+ _Zyyy = 260
+ _Zzzz = 261
+)
+
+var regionToGroups = []uint8{ // 359 elements
+ // Entry 0 - 3F
+ 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04,
+ 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00,
+ 0x00, 0x04, 0x00, 0x00, 0x04, 0x01, 0x00, 0x00,
+ 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x04,
+ // Entry 40 - 7F
+ 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04,
+ 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00,
+ 0x08, 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04,
+ // Entry 80 - BF
+ 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00,
+ 0x00, 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00,
+ 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00,
+ 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04,
+ // Entry C0 - FF
+ 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02,
+ 0x01, 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00,
+ 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00,
+ 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 100 - 13F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04,
+ 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00,
+ 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04,
+ 0x00, 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00,
+ // Entry 140 - 17F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+} // Size: 383 bytes
+
+var paradigmLocales = [][3]uint16{ // 3 elements
+ 0: [3]uint16{0x139, 0x0, 0x7c},
+ 1: [3]uint16{0x13e, 0x0, 0x1f},
+ 2: [3]uint16{0x3c0, 0x41, 0xef},
+} // Size: 42 bytes
+
+type mutualIntelligibility struct {
+ want uint16
+ have uint16
+ distance uint8
+ oneway bool
+}
+type scriptIntelligibility struct {
+ wantLang uint16
+ haveLang uint16
+ wantScript uint8
+ haveScript uint8
+ distance uint8
+}
+type regionIntelligibility struct {
+ lang uint16
+ script uint8
+ group uint8
+ distance uint8
+}
+
+// matchLang holds pairs of langIDs of base languages that are typically
+// mutually intelligible. Each pair is associated with a confidence and
+// whether the intelligibility goes one or both ways.
+var matchLang = []mutualIntelligibility{ // 113 elements
+ 0: {want: 0x1d1, have: 0xb7, distance: 0x4, oneway: false},
+ 1: {want: 0x407, have: 0xb7, distance: 0x4, oneway: false},
+ 2: {want: 0x407, have: 0x1d1, distance: 0x4, oneway: false},
+ 3: {want: 0x407, have: 0x432, distance: 0x4, oneway: false},
+ 4: {want: 0x43a, have: 0x1, distance: 0x4, oneway: false},
+ 5: {want: 0x1a3, have: 0x10d, distance: 0x4, oneway: true},
+ 6: {want: 0x295, have: 0x10d, distance: 0x4, oneway: true},
+ 7: {want: 0x101, have: 0x36f, distance: 0x8, oneway: false},
+ 8: {want: 0x101, have: 0x347, distance: 0x8, oneway: false},
+ 9: {want: 0x5, have: 0x3e2, distance: 0xa, oneway: true},
+ 10: {want: 0xd, have: 0x139, distance: 0xa, oneway: true},
+ 11: {want: 0x16, have: 0x367, distance: 0xa, oneway: true},
+ 12: {want: 0x21, have: 0x139, distance: 0xa, oneway: true},
+ 13: {want: 0x56, have: 0x13e, distance: 0xa, oneway: true},
+ 14: {want: 0x58, have: 0x3e2, distance: 0xa, oneway: true},
+ 15: {want: 0x71, have: 0x3e2, distance: 0xa, oneway: true},
+ 16: {want: 0x75, have: 0x139, distance: 0xa, oneway: true},
+ 17: {want: 0x82, have: 0x1be, distance: 0xa, oneway: true},
+ 18: {want: 0xa5, have: 0x139, distance: 0xa, oneway: true},
+ 19: {want: 0xb2, have: 0x15e, distance: 0xa, oneway: true},
+ 20: {want: 0xdd, have: 0x153, distance: 0xa, oneway: true},
+ 21: {want: 0xe5, have: 0x139, distance: 0xa, oneway: true},
+ 22: {want: 0xe9, have: 0x3a, distance: 0xa, oneway: true},
+ 23: {want: 0xf0, have: 0x15e, distance: 0xa, oneway: true},
+ 24: {want: 0xf9, have: 0x15e, distance: 0xa, oneway: true},
+ 25: {want: 0x100, have: 0x139, distance: 0xa, oneway: true},
+ 26: {want: 0x130, have: 0x139, distance: 0xa, oneway: true},
+ 27: {want: 0x13c, have: 0x139, distance: 0xa, oneway: true},
+ 28: {want: 0x140, have: 0x151, distance: 0xa, oneway: true},
+ 29: {want: 0x145, have: 0x13e, distance: 0xa, oneway: true},
+ 30: {want: 0x158, have: 0x101, distance: 0xa, oneway: true},
+ 31: {want: 0x16d, have: 0x367, distance: 0xa, oneway: true},
+ 32: {want: 0x16e, have: 0x139, distance: 0xa, oneway: true},
+ 33: {want: 0x16f, have: 0x139, distance: 0xa, oneway: true},
+ 34: {want: 0x17e, have: 0x139, distance: 0xa, oneway: true},
+ 35: {want: 0x190, have: 0x13e, distance: 0xa, oneway: true},
+ 36: {want: 0x194, have: 0x13e, distance: 0xa, oneway: true},
+ 37: {want: 0x1a4, have: 0x1be, distance: 0xa, oneway: true},
+ 38: {want: 0x1b4, have: 0x139, distance: 0xa, oneway: true},
+ 39: {want: 0x1b8, have: 0x139, distance: 0xa, oneway: true},
+ 40: {want: 0x1d4, have: 0x15e, distance: 0xa, oneway: true},
+ 41: {want: 0x1d7, have: 0x3e2, distance: 0xa, oneway: true},
+ 42: {want: 0x1d9, have: 0x139, distance: 0xa, oneway: true},
+ 43: {want: 0x1e7, have: 0x139, distance: 0xa, oneway: true},
+ 44: {want: 0x1f8, have: 0x139, distance: 0xa, oneway: true},
+ 45: {want: 0x20e, have: 0x1e1, distance: 0xa, oneway: true},
+ 46: {want: 0x210, have: 0x139, distance: 0xa, oneway: true},
+ 47: {want: 0x22d, have: 0x15e, distance: 0xa, oneway: true},
+ 48: {want: 0x242, have: 0x3e2, distance: 0xa, oneway: true},
+ 49: {want: 0x24a, have: 0x139, distance: 0xa, oneway: true},
+ 50: {want: 0x251, have: 0x139, distance: 0xa, oneway: true},
+ 51: {want: 0x265, have: 0x139, distance: 0xa, oneway: true},
+ 52: {want: 0x274, have: 0x48a, distance: 0xa, oneway: true},
+ 53: {want: 0x28a, have: 0x3e2, distance: 0xa, oneway: true},
+ 54: {want: 0x28e, have: 0x1f9, distance: 0xa, oneway: true},
+ 55: {want: 0x2a3, have: 0x139, distance: 0xa, oneway: true},
+ 56: {want: 0x2b5, have: 0x15e, distance: 0xa, oneway: true},
+ 57: {want: 0x2b8, have: 0x139, distance: 0xa, oneway: true},
+ 58: {want: 0x2be, have: 0x139, distance: 0xa, oneway: true},
+ 59: {want: 0x2c3, have: 0x15e, distance: 0xa, oneway: true},
+ 60: {want: 0x2ed, have: 0x139, distance: 0xa, oneway: true},
+ 61: {want: 0x2f1, have: 0x15e, distance: 0xa, oneway: true},
+ 62: {want: 0x2fa, have: 0x139, distance: 0xa, oneway: true},
+ 63: {want: 0x2ff, have: 0x7e, distance: 0xa, oneway: true},
+ 64: {want: 0x304, have: 0x139, distance: 0xa, oneway: true},
+ 65: {want: 0x30b, have: 0x3e2, distance: 0xa, oneway: true},
+ 66: {want: 0x31b, have: 0x1be, distance: 0xa, oneway: true},
+ 67: {want: 0x31f, have: 0x1e1, distance: 0xa, oneway: true},
+ 68: {want: 0x320, have: 0x139, distance: 0xa, oneway: true},
+ 69: {want: 0x331, have: 0x139, distance: 0xa, oneway: true},
+ 70: {want: 0x351, have: 0x139, distance: 0xa, oneway: true},
+ 71: {want: 0x36a, have: 0x347, distance: 0xa, oneway: false},
+ 72: {want: 0x36a, have: 0x36f, distance: 0xa, oneway: true},
+ 73: {want: 0x37a, have: 0x139, distance: 0xa, oneway: true},
+ 74: {want: 0x387, have: 0x139, distance: 0xa, oneway: true},
+ 75: {want: 0x389, have: 0x139, distance: 0xa, oneway: true},
+ 76: {want: 0x38b, have: 0x15e, distance: 0xa, oneway: true},
+ 77: {want: 0x390, have: 0x139, distance: 0xa, oneway: true},
+ 78: {want: 0x395, have: 0x139, distance: 0xa, oneway: true},
+ 79: {want: 0x39d, have: 0x139, distance: 0xa, oneway: true},
+ 80: {want: 0x3a5, have: 0x139, distance: 0xa, oneway: true},
+ 81: {want: 0x3be, have: 0x139, distance: 0xa, oneway: true},
+ 82: {want: 0x3c4, have: 0x13e, distance: 0xa, oneway: true},
+ 83: {want: 0x3d4, have: 0x10d, distance: 0xa, oneway: true},
+ 84: {want: 0x3d9, have: 0x139, distance: 0xa, oneway: true},
+ 85: {want: 0x3e5, have: 0x15e, distance: 0xa, oneway: true},
+ 86: {want: 0x3e9, have: 0x1be, distance: 0xa, oneway: true},
+ 87: {want: 0x3fa, have: 0x139, distance: 0xa, oneway: true},
+ 88: {want: 0x40c, have: 0x139, distance: 0xa, oneway: true},
+ 89: {want: 0x423, have: 0x139, distance: 0xa, oneway: true},
+ 90: {want: 0x429, have: 0x139, distance: 0xa, oneway: true},
+ 91: {want: 0x431, have: 0x139, distance: 0xa, oneway: true},
+ 92: {want: 0x43b, have: 0x139, distance: 0xa, oneway: true},
+ 93: {want: 0x43e, have: 0x1e1, distance: 0xa, oneway: true},
+ 94: {want: 0x445, have: 0x139, distance: 0xa, oneway: true},
+ 95: {want: 0x450, have: 0x139, distance: 0xa, oneway: true},
+ 96: {want: 0x461, have: 0x139, distance: 0xa, oneway: true},
+ 97: {want: 0x467, have: 0x3e2, distance: 0xa, oneway: true},
+ 98: {want: 0x46f, have: 0x139, distance: 0xa, oneway: true},
+ 99: {want: 0x476, have: 0x3e2, distance: 0xa, oneway: true},
+ 100: {want: 0x3883, have: 0x139, distance: 0xa, oneway: true},
+ 101: {want: 0x480, have: 0x139, distance: 0xa, oneway: true},
+ 102: {want: 0x482, have: 0x139, distance: 0xa, oneway: true},
+ 103: {want: 0x494, have: 0x3e2, distance: 0xa, oneway: true},
+ 104: {want: 0x49d, have: 0x139, distance: 0xa, oneway: true},
+ 105: {want: 0x4ac, have: 0x529, distance: 0xa, oneway: true},
+ 106: {want: 0x4b4, have: 0x139, distance: 0xa, oneway: true},
+ 107: {want: 0x4bc, have: 0x3e2, distance: 0xa, oneway: true},
+ 108: {want: 0x4e5, have: 0x15e, distance: 0xa, oneway: true},
+ 109: {want: 0x4f2, have: 0x139, distance: 0xa, oneway: true},
+ 110: {want: 0x512, have: 0x139, distance: 0xa, oneway: true},
+ 111: {want: 0x518, have: 0x139, distance: 0xa, oneway: true},
+ 112: {want: 0x52f, have: 0x139, distance: 0xa, oneway: true},
+} // Size: 702 bytes
+
+// matchScript holds pairs of scriptIDs where readers of one script
+// can typically also read the other. Each is associated with a confidence.
+var matchScript = []scriptIntelligibility{ // 26 elements
+ 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5b, haveScript: 0x20, distance: 0x5},
+ 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5b, distance: 0x5},
+ 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa},
+ 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5b, distance: 0xa},
+ 4: {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x20, distance: 0xa},
+ 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5b, distance: 0xa},
+ 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4f, haveScript: 0x5b, distance: 0xa},
+ 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x53, haveScript: 0x5b, distance: 0xa},
+ 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x58, haveScript: 0x5b, distance: 0xa},
+ 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6f, haveScript: 0x5b, distance: 0xa},
+ 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x76, haveScript: 0x5b, distance: 0xa},
+ 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5b, distance: 0xa},
+ 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x83, haveScript: 0x5b, distance: 0xa},
+ 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5b, distance: 0xa},
+ 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa},
+ 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa},
+ 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd6, haveScript: 0x5b, distance: 0xa},
+ 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5b, distance: 0xa},
+ 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe9, haveScript: 0x5b, distance: 0xa},
+ 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5b, distance: 0xa},
+ 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa},
+ 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa},
+ 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa},
+ 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5b, distance: 0xa},
+ 24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3b, haveScript: 0x3c, distance: 0xf},
+ 25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3c, haveScript: 0x3b, distance: 0x13},
+} // Size: 232 bytes
+
+var matchRegion = []regionIntelligibility{ // 15 elements
+ 0: {lang: 0x3a, script: 0x0, group: 0x4, distance: 0x4},
+ 1: {lang: 0x3a, script: 0x0, group: 0x84, distance: 0x4},
+ 2: {lang: 0x139, script: 0x0, group: 0x1, distance: 0x4},
+ 3: {lang: 0x139, script: 0x0, group: 0x81, distance: 0x4},
+ 4: {lang: 0x13e, script: 0x0, group: 0x3, distance: 0x4},
+ 5: {lang: 0x13e, script: 0x0, group: 0x83, distance: 0x4},
+ 6: {lang: 0x3c0, script: 0x0, group: 0x3, distance: 0x4},
+ 7: {lang: 0x3c0, script: 0x0, group: 0x83, distance: 0x4},
+ 8: {lang: 0x529, script: 0x3c, group: 0x2, distance: 0x4},
+ 9: {lang: 0x529, script: 0x3c, group: 0x82, distance: 0x4},
+ 10: {lang: 0x3a, script: 0x0, group: 0x80, distance: 0x5},
+ 11: {lang: 0x139, script: 0x0, group: 0x80, distance: 0x5},
+ 12: {lang: 0x13e, script: 0x0, group: 0x80, distance: 0x5},
+ 13: {lang: 0x3c0, script: 0x0, group: 0x80, distance: 0x5},
+ 14: {lang: 0x529, script: 0x3c, group: 0x80, distance: 0x5},
+} // Size: 114 bytes
+
+// Total table size 1473 bytes (1KiB); checksum: 7BB90B5C
diff --git a/vendor/golang.org/x/text/language/tags.go b/vendor/golang.org/x/text/language/tags.go
@@ -0,0 +1,145 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import "golang.org/x/text/internal/language/compact"
+
+// TODO: Various sets of commonly use tags and regions.
+
+// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed.
+// It simplifies safe initialization of Tag values.
+func MustParse(s string) Tag {
+ t, err := Parse(s)
+ if err != nil {
+ panic(err)
+ }
+ return t
+}
+
+// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed.
+// It simplifies safe initialization of Tag values.
+func (c CanonType) MustParse(s string) Tag {
+ t, err := c.Parse(s)
+ if err != nil {
+ panic(err)
+ }
+ return t
+}
+
+// MustParseBase is like ParseBase, but panics if the given base cannot be parsed.
+// It simplifies safe initialization of Base values.
+func MustParseBase(s string) Base {
+ b, err := ParseBase(s)
+ if err != nil {
+ panic(err)
+ }
+ return b
+}
+
+// MustParseScript is like ParseScript, but panics if the given script cannot be
+// parsed. It simplifies safe initialization of Script values.
+func MustParseScript(s string) Script {
+ scr, err := ParseScript(s)
+ if err != nil {
+ panic(err)
+ }
+ return scr
+}
+
+// MustParseRegion is like ParseRegion, but panics if the given region cannot be
+// parsed. It simplifies safe initialization of Region values.
+func MustParseRegion(s string) Region {
+ r, err := ParseRegion(s)
+ if err != nil {
+ panic(err)
+ }
+ return r
+}
+
+var (
+ und = Tag{}
+
+ Und Tag = Tag{}
+
+ Afrikaans Tag = Tag(compact.Afrikaans)
+ Amharic Tag = Tag(compact.Amharic)
+ Arabic Tag = Tag(compact.Arabic)
+ ModernStandardArabic Tag = Tag(compact.ModernStandardArabic)
+ Azerbaijani Tag = Tag(compact.Azerbaijani)
+ Bulgarian Tag = Tag(compact.Bulgarian)
+ Bengali Tag = Tag(compact.Bengali)
+ Catalan Tag = Tag(compact.Catalan)
+ Czech Tag = Tag(compact.Czech)
+ Danish Tag = Tag(compact.Danish)
+ German Tag = Tag(compact.German)
+ Greek Tag = Tag(compact.Greek)
+ English Tag = Tag(compact.English)
+ AmericanEnglish Tag = Tag(compact.AmericanEnglish)
+ BritishEnglish Tag = Tag(compact.BritishEnglish)
+ Spanish Tag = Tag(compact.Spanish)
+ EuropeanSpanish Tag = Tag(compact.EuropeanSpanish)
+ LatinAmericanSpanish Tag = Tag(compact.LatinAmericanSpanish)
+ Estonian Tag = Tag(compact.Estonian)
+ Persian Tag = Tag(compact.Persian)
+ Finnish Tag = Tag(compact.Finnish)
+ Filipino Tag = Tag(compact.Filipino)
+ French Tag = Tag(compact.French)
+ CanadianFrench Tag = Tag(compact.CanadianFrench)
+ Gujarati Tag = Tag(compact.Gujarati)
+ Hebrew Tag = Tag(compact.Hebrew)
+ Hindi Tag = Tag(compact.Hindi)
+ Croatian Tag = Tag(compact.Croatian)
+ Hungarian Tag = Tag(compact.Hungarian)
+ Armenian Tag = Tag(compact.Armenian)
+ Indonesian Tag = Tag(compact.Indonesian)
+ Icelandic Tag = Tag(compact.Icelandic)
+ Italian Tag = Tag(compact.Italian)
+ Japanese Tag = Tag(compact.Japanese)
+ Georgian Tag = Tag(compact.Georgian)
+ Kazakh Tag = Tag(compact.Kazakh)
+ Khmer Tag = Tag(compact.Khmer)
+ Kannada Tag = Tag(compact.Kannada)
+ Korean Tag = Tag(compact.Korean)
+ Kirghiz Tag = Tag(compact.Kirghiz)
+ Lao Tag = Tag(compact.Lao)
+ Lithuanian Tag = Tag(compact.Lithuanian)
+ Latvian Tag = Tag(compact.Latvian)
+ Macedonian Tag = Tag(compact.Macedonian)
+ Malayalam Tag = Tag(compact.Malayalam)
+ Mongolian Tag = Tag(compact.Mongolian)
+ Marathi Tag = Tag(compact.Marathi)
+ Malay Tag = Tag(compact.Malay)
+ Burmese Tag = Tag(compact.Burmese)
+ Nepali Tag = Tag(compact.Nepali)
+ Dutch Tag = Tag(compact.Dutch)
+ Norwegian Tag = Tag(compact.Norwegian)
+ Punjabi Tag = Tag(compact.Punjabi)
+ Polish Tag = Tag(compact.Polish)
+ Portuguese Tag = Tag(compact.Portuguese)
+ BrazilianPortuguese Tag = Tag(compact.BrazilianPortuguese)
+ EuropeanPortuguese Tag = Tag(compact.EuropeanPortuguese)
+ Romanian Tag = Tag(compact.Romanian)
+ Russian Tag = Tag(compact.Russian)
+ Sinhala Tag = Tag(compact.Sinhala)
+ Slovak Tag = Tag(compact.Slovak)
+ Slovenian Tag = Tag(compact.Slovenian)
+ Albanian Tag = Tag(compact.Albanian)
+ Serbian Tag = Tag(compact.Serbian)
+ SerbianLatin Tag = Tag(compact.SerbianLatin)
+ Swedish Tag = Tag(compact.Swedish)
+ Swahili Tag = Tag(compact.Swahili)
+ Tamil Tag = Tag(compact.Tamil)
+ Telugu Tag = Tag(compact.Telugu)
+ Thai Tag = Tag(compact.Thai)
+ Turkish Tag = Tag(compact.Turkish)
+ Ukrainian Tag = Tag(compact.Ukrainian)
+ Urdu Tag = Tag(compact.Urdu)
+ Uzbek Tag = Tag(compact.Uzbek)
+ Vietnamese Tag = Tag(compact.Vietnamese)
+ Chinese Tag = Tag(compact.Chinese)
+ SimplifiedChinese Tag = Tag(compact.SimplifiedChinese)
+ TraditionalChinese Tag = Tag(compact.TraditionalChinese)
+ Zulu Tag = Tag(compact.Zulu)
+)
diff --git a/vendor/gopkg.in/ini.v1/.editorconfig b/vendor/gopkg.in/ini.v1/.editorconfig
@@ -0,0 +1,12 @@
+# http://editorconfig.org
+
+root = true
+
+[*]
+charset = utf-8
+end_of_line = lf
+insert_final_newline = true
+trim_trailing_whitespace = true
+
+[*_test.go]
+trim_trailing_whitespace = false
diff --git a/vendor/gopkg.in/ini.v1/.gitignore b/vendor/gopkg.in/ini.v1/.gitignore
@@ -0,0 +1,7 @@
+testdata/conf_out.ini
+ini.sublime-project
+ini.sublime-workspace
+testdata/conf_reflect.ini
+.idea
+/.vscode
+.DS_Store
diff --git a/vendor/gopkg.in/ini.v1/.golangci.yml b/vendor/gopkg.in/ini.v1/.golangci.yml
@@ -0,0 +1,36 @@
+version: "2"
+linters:
+ enable:
+ - nakedret
+ - rowserrcheck
+ - unconvert
+ - unparam
+ settings:
+ govet:
+ disable:
+ # printf: non-constant format string in call to fmt.Errorf (govet)
+ # showing up since golangci-lint version 1.60.1
+ - printf
+ nakedret:
+ max-func-lines: 0 # Disallow any unnamed return statement
+ exclusions:
+ generated: lax
+ presets:
+ - comments
+ - common-false-positives
+ - legacy
+ - std-error-handling
+ paths:
+ - third_party$
+ - builtin$
+ - examples$
+formatters:
+ enable:
+ - gofmt
+ - goimports
+ exclusions:
+ generated: lax
+ paths:
+ - third_party$
+ - builtin$
+ - examples$
diff --git a/vendor/gopkg.in/ini.v1/LICENSE b/vendor/gopkg.in/ini.v1/LICENSE
@@ -0,0 +1,191 @@
+Apache License
+Version 2.0, January 2004
+http://www.apache.org/licenses/
+
+TERMS AND CONDITIONS FOR USE, REPRODUCTION, AND DISTRIBUTION
+
+1. Definitions.
+
+"License" shall mean the terms and conditions for use, reproduction, and
+distribution as defined by Sections 1 through 9 of this document.
+
+"Licensor" shall mean the copyright owner or entity authorized by the copyright
+owner that is granting the License.
+
+"Legal Entity" shall mean the union of the acting entity and all other entities
+that control, are controlled by, or are under common control with that entity.
+For the purposes of this definition, "control" means (i) the power, direct or
+indirect, to cause the direction or management of such entity, whether by
+contract or otherwise, or (ii) ownership of fifty percent (50%) or more of the
+outstanding shares, or (iii) beneficial ownership of such entity.
+
+"You" (or "Your") shall mean an individual or Legal Entity exercising
+permissions granted by this License.
+
+"Source" form shall mean the preferred form for making modifications, including
+but not limited to software source code, documentation source, and configuration
+files.
+
+"Object" form shall mean any form resulting from mechanical transformation or
+translation of a Source form, including but not limited to compiled object code,
+generated documentation, and conversions to other media types.
+
+"Work" shall mean the work of authorship, whether in Source or Object form, made
+available under the License, as indicated by a copyright notice that is included
+in or attached to the work (an example is provided in the Appendix below).
+
+"Derivative Works" shall mean any work, whether in Source or Object form, that
+is based on (or derived from) the Work and for which the editorial revisions,
+annotations, elaborations, or other modifications represent, as a whole, an
+original work of authorship. For the purposes of this License, Derivative Works
+shall not include works that remain separable from, or merely link (or bind by
+name) to the interfaces of, the Work and Derivative Works thereof.
+
+"Contribution" shall mean any work of authorship, including the original version
+of the Work and any modifications or additions to that Work or Derivative Works
+thereof, that is intentionally submitted to Licensor for inclusion in the Work
+by the copyright owner or by an individual or Legal Entity authorized to submit
+on behalf of the copyright owner. For the purposes of this definition,
+"submitted" means any form of electronic, verbal, or written communication sent
+to the Licensor or its representatives, including but not limited to
+communication on electronic mailing lists, source code control systems, and
+issue tracking systems that are managed by, or on behalf of, the Licensor for
+the purpose of discussing and improving the Work, but excluding communication
+that is conspicuously marked or otherwise designated in writing by the copyright
+owner as "Not a Contribution."
+
+"Contributor" shall mean Licensor and any individual or Legal Entity on behalf
+of whom a Contribution has been received by Licensor and subsequently
+incorporated within the Work.
+
+2. Grant of Copyright License.
+
+Subject to the terms and conditions of this License, each Contributor hereby
+grants to You a perpetual, worldwide, non-exclusive, no-charge, royalty-free,
+irrevocable copyright license to reproduce, prepare Derivative Works of,
+publicly display, publicly perform, sublicense, and distribute the Work and such
+Derivative Works in Source or Object form.
+
+3. Grant of Patent License.
+
+Subject to the terms and conditions of this License, each Contributor hereby
+grants to You a perpetual, worldwide, non-exclusive, no-charge, royalty-free,
+irrevocable (except as stated in this section) patent license to make, have
+made, use, offer to sell, sell, import, and otherwise transfer the Work, where
+such license applies only to those patent claims licensable by such Contributor
+that are necessarily infringed by their Contribution(s) alone or by combination
+of their Contribution(s) with the Work to which such Contribution(s) was
+submitted. If You institute patent litigation against any entity (including a
+cross-claim or counterclaim in a lawsuit) alleging that the Work or a
+Contribution incorporated within the Work constitutes direct or contributory
+patent infringement, then any patent licenses granted to You under this License
+for that Work shall terminate as of the date such litigation is filed.
+
+4. Redistribution.
+
+You may reproduce and distribute copies of the Work or Derivative Works thereof
+in any medium, with or without modifications, and in Source or Object form,
+provided that You meet the following conditions:
+
+You must give any other recipients of the Work or Derivative Works a copy of
+this License; and
+You must cause any modified files to carry prominent notices stating that You
+changed the files; and
+You must retain, in the Source form of any Derivative Works that You distribute,
+all copyright, patent, trademark, and attribution notices from the Source form
+of the Work, excluding those notices that do not pertain to any part of the
+Derivative Works; and
+If the Work includes a "NOTICE" text file as part of its distribution, then any
+Derivative Works that You distribute must include a readable copy of the
+attribution notices contained within such NOTICE file, excluding those notices
+that do not pertain to any part of the Derivative Works, in at least one of the
+following places: within a NOTICE text file distributed as part of the
+Derivative Works; within the Source form or documentation, if provided along
+with the Derivative Works; or, within a display generated by the Derivative
+Works, if and wherever such third-party notices normally appear. The contents of
+the NOTICE file are for informational purposes only and do not modify the
+License. You may add Your own attribution notices within Derivative Works that
+You distribute, alongside or as an addendum to the NOTICE text from the Work,
+provided that such additional attribution notices cannot be construed as
+modifying the License.
+You may add Your own copyright statement to Your modifications and may provide
+additional or different license terms and conditions for use, reproduction, or
+distribution of Your modifications, or for any such Derivative Works as a whole,
+provided Your use, reproduction, and distribution of the Work otherwise complies
+with the conditions stated in this License.
+
+5. Submission of Contributions.
+
+Unless You explicitly state otherwise, any Contribution intentionally submitted
+for inclusion in the Work by You to the Licensor shall be under the terms and
+conditions of this License, without any additional terms or conditions.
+Notwithstanding the above, nothing herein shall supersede or modify the terms of
+any separate license agreement you may have executed with Licensor regarding
+such Contributions.
+
+6. Trademarks.
+
+This License does not grant permission to use the trade names, trademarks,
+service marks, or product names of the Licensor, except as required for
+reasonable and customary use in describing the origin of the Work and
+reproducing the content of the NOTICE file.
+
+7. Disclaimer of Warranty.
+
+Unless required by applicable law or agreed to in writing, Licensor provides the
+Work (and each Contributor provides its Contributions) on an "AS IS" BASIS,
+WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied,
+including, without limitation, any warranties or conditions of TITLE,
+NON-INFRINGEMENT, MERCHANTABILITY, or FITNESS FOR A PARTICULAR PURPOSE. You are
+solely responsible for determining the appropriateness of using or
+redistributing the Work and assume any risks associated with Your exercise of
+permissions under this License.
+
+8. Limitation of Liability.
+
+In no event and under no legal theory, whether in tort (including negligence),
+contract, or otherwise, unless required by applicable law (such as deliberate
+and grossly negligent acts) or agreed to in writing, shall any Contributor be
+liable to You for damages, including any direct, indirect, special, incidental,
+or consequential damages of any character arising as a result of this License or
+out of the use or inability to use the Work (including but not limited to
+damages for loss of goodwill, work stoppage, computer failure or malfunction, or
+any and all other commercial damages or losses), even if such Contributor has
+been advised of the possibility of such damages.
+
+9. Accepting Warranty or Additional Liability.
+
+While redistributing the Work or Derivative Works thereof, You may choose to
+offer, and charge a fee for, acceptance of support, warranty, indemnity, or
+other liability obligations and/or rights consistent with this License. However,
+in accepting such obligations, You may act only on Your own behalf and on Your
+sole responsibility, not on behalf of any other Contributor, and only if You
+agree to indemnify, defend, and hold each Contributor harmless for any liability
+incurred by, or claims asserted against, such Contributor by reason of your
+accepting any such warranty or additional liability.
+
+END OF TERMS AND CONDITIONS
+
+APPENDIX: How to apply the Apache License to your work
+
+To apply the Apache License to your work, attach the following boilerplate
+notice, with the fields enclosed by brackets "[]" replaced with your own
+identifying information. (Don't include the brackets!) The text should be
+enclosed in the appropriate comment syntax for the file format. We also
+recommend that a file or class name and description of purpose be included on
+the same "printed page" as the copyright notice for easier identification within
+third-party archives.
+
+ Copyright 2014 Unknwon
+
+ Licensed under the Apache License, Version 2.0 (the "License");
+ you may not use this file except in compliance with the License.
+ You may obtain a copy of the License at
+
+ http://www.apache.org/licenses/LICENSE-2.0
+
+ Unless required by applicable law or agreed to in writing, software
+ distributed under the License is distributed on an "AS IS" BASIS,
+ WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ See the License for the specific language governing permissions and
+ limitations under the License.
diff --git a/vendor/gopkg.in/ini.v1/README.md b/vendor/gopkg.in/ini.v1/README.md
@@ -0,0 +1,45 @@
+# INI
+
+[](https://github.com/go-ini/ini/actions?query=branch%3Amain)
+[](https://pkg.go.dev/github.com/go-ini/ini?tab=doc)
+
+
+
+Package ini provides INI file read and write functionality in Go.
+
+## Features
+
+- Load from multiple data sources(file, `[]byte`, `io.Reader` and `io.ReadCloser`) with overwrites.
+- Read with recursion values.
+- Read with parent-child sections.
+- Read with auto-increment key names.
+- Read with multiple-line values.
+- Read with tons of helper methods.
+- Read and convert values to Go types.
+- Read and **WRITE** comments of sections and keys.
+- Manipulate sections, keys and comments with ease.
+- Keep sections and keys in order as you parse and save.
+
+## Installation
+
+The minimum requirement of Go is **1.13**.
+
+```sh
+$ go get gopkg.in/ini.v1@latest
+```
+
+> [!NOTE]
+> If you previously used `github.com/go-ini/ini` as the import path in your project, without updating all of your code, you can use the following command to replace the import path in your `go.mod`:
+> ```zsh
+> go mod edit -replace github.com/go-ini/ini=gopkg.in/ini.v1@latest
+> ```
+
+## Getting Help
+
+- [Getting Started](https://ini.unknwon.io/docs/intro/getting_started)
+- [API Documentation](https://gowalker.org/gopkg.in/ini.v1)
+- 中国大陆镜像：https://ini.unknwon.cn
+
+## License
+
+This project is under Apache v2 License. See the [LICENSE](LICENSE) file for the full license text.
diff --git a/vendor/gopkg.in/ini.v1/codecov.yml b/vendor/gopkg.in/ini.v1/codecov.yml
@@ -0,0 +1,16 @@
+coverage:
+ range: "60...95"
+ status:
+ project:
+ default:
+ threshold: 1%
+ informational: true
+ patch:
+ defualt:
+ only_pulls: true
+ informational: true
+
+comment:
+ layout: 'diff'
+
+github_checks: false
diff --git a/vendor/gopkg.in/ini.v1/data_source.go b/vendor/gopkg.in/ini.v1/data_source.go
@@ -0,0 +1,76 @@
+// Copyright 2019 Unknwon
+//
+// Licensed under the Apache License, Version 2.0 (the "License"): you may
+// not use this file except in compliance with the License. You may obtain
+// a copy of the License at
+//
+// http://www.apache.org/licenses/LICENSE-2.0
+//
+// Unless required by applicable law or agreed to in writing, software
+// distributed under the License is distributed on an "AS IS" BASIS, WITHOUT
+// WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the
+// License for the specific language governing permissions and limitations
+// under the License.
+
+package ini
+
+import (
+ "bytes"
+ "fmt"
+ "io"
+ "io/ioutil"
+ "os"
+)
+
+var (
+ _ dataSource = (*sourceFile)(nil)
+ _ dataSource = (*sourceData)(nil)
+ _ dataSource = (*sourceReadCloser)(nil)
+)
+
+// dataSource is an interface that returns object which can be read and closed.
+type dataSource interface {
+ ReadCloser() (io.ReadCloser, error)
+}
+
+// sourceFile represents an object that contains content on the local file system.
+type sourceFile struct {
+ name string
+}
+
+func (s sourceFile) ReadCloser() (_ io.ReadCloser, err error) {
+ return os.Open(s.name)
+}
+
+// sourceData represents an object that contains content in memory.
+type sourceData struct {
+ data []byte
+}
+
+func (s *sourceData) ReadCloser() (io.ReadCloser, error) {
+ return ioutil.NopCloser(bytes.NewReader(s.data)), nil
+}
+
+// sourceReadCloser represents an input stream with Close method.
+type sourceReadCloser struct {
+ reader io.ReadCloser
+}
+
+func (s *sourceReadCloser) ReadCloser() (io.ReadCloser, error) {
+ return s.reader, nil
+}
+
+func parseDataSource(source interface{}) (dataSource, error) {
+ switch s := source.(type) {
+ case string:
+ return sourceFile{s}, nil
+ case []byte:
+ return &sourceData{s}, nil
+ case io.ReadCloser:
+ return &sourceReadCloser{s}, nil
+ case io.Reader:
+ return &sourceReadCloser{ioutil.NopCloser(s)}, nil
+ default:
+ return nil, fmt.Errorf("error parsing data source: unknown type %q", s)
+ }
+}
diff --git a/vendor/gopkg.in/ini.v1/deprecated.go b/vendor/gopkg.in/ini.v1/deprecated.go
@@ -0,0 +1,22 @@
+// Copyright 2019 Unknwon
+//
+// Licensed under the Apache License, Version 2.0 (the "License"): you may
+// not use this file except in compliance with the License. You may obtain
+// a copy of the License at
+//
+// http://www.apache.org/licenses/LICENSE-2.0
+//
+// Unless required by applicable law or agreed to in writing, software
+// distributed under the License is distributed on an "AS IS" BASIS, WITHOUT
+// WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the
+// License for the specific language governing permissions and limitations
+// under the License.
+
+package ini
+
+var (
+ // Deprecated: Use "DefaultSection" instead.
+ DEFAULT_SECTION = DefaultSection
+ // Deprecated: AllCapsUnderscore converts to format ALL_CAPS_UNDERSCORE.
+ AllCapsUnderscore = SnackCase
+)
diff --git a/vendor/gopkg.in/ini.v1/error.go b/vendor/gopkg.in/ini.v1/error.go
@@ -0,0 +1,49 @@
+// Copyright 2016 Unknwon
+//
+// Licensed under the Apache License, Version 2.0 (the "License"): you may
+// not use this file except in compliance with the License. You may obtain
+// a copy of the License at
+//
+// http://www.apache.org/licenses/LICENSE-2.0
+//
+// Unless required by applicable law or agreed to in writing, software
+// distributed under the License is distributed on an "AS IS" BASIS, WITHOUT
+// WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the
+// License for the specific language governing permissions and limitations
+// under the License.
+
+package ini
+
+import (
+ "fmt"
+)
+
+// ErrDelimiterNotFound indicates the error type of no delimiter is found which there should be one.
+type ErrDelimiterNotFound struct {
+ Line string
+}
+
+// IsErrDelimiterNotFound returns true if the given error is an instance of ErrDelimiterNotFound.
+func IsErrDelimiterNotFound(err error) bool {
+ _, ok := err.(ErrDelimiterNotFound)
+ return ok
+}
+
+func (err ErrDelimiterNotFound) Error() string {
+ return fmt.Sprintf("key-value delimiter not found: %s", err.Line)
+}
+
+// ErrEmptyKeyName indicates the error type of no key name is found which there should be one.
+type ErrEmptyKeyName struct {
+ Line string
+}
+
+// IsErrEmptyKeyName returns true if the given error is an instance of ErrEmptyKeyName.
+func IsErrEmptyKeyName(err error) bool {
+ _, ok := err.(ErrEmptyKeyName)
+ return ok
+}
+
+func (err ErrEmptyKeyName) Error() string {
+ return fmt.Sprintf("empty key name: %s", err.Line)
+}
diff --git a/vendor/gopkg.in/ini.v1/file.go b/vendor/gopkg.in/ini.v1/file.go
@@ -0,0 +1,541 @@
+// Copyright 2017 Unknwon
+//
+// Licensed under the Apache License, Version 2.0 (the "License"): you may
+// not use this file except in compliance with the License. You may obtain
+// a copy of the License at
+//
+// http://www.apache.org/licenses/LICENSE-2.0
+//
+// Unless required by applicable law or agreed to in writing, software
+// distributed under the License is distributed on an "AS IS" BASIS, WITHOUT
+// WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the
+// License for the specific language governing permissions and limitations
+// under the License.
+
+package ini
+
+import (
+ "bytes"
+ "errors"
+ "fmt"
+ "io"
+ "io/ioutil"
+ "os"
+ "strings"
+ "sync"
+)
+
+// File represents a combination of one or more INI files in memory.
+type File struct {
+ options LoadOptions
+ dataSources []dataSource
+
+ // Should make things safe, but sometimes doesn't matter.
+ BlockMode bool
+ lock sync.RWMutex
+
+ // To keep data in order.
+ sectionList []string
+ // To keep track of the index of a section with same name.
+ // This meta list is only used with non-unique section names are allowed.
+ sectionIndexes []int
+
+ // Actual data is stored here.
+ sections map[string][]*Section
+
+ NameMapper
+ ValueMapper
+}
+
+// newFile initializes File object with given data sources.
+func newFile(dataSources []dataSource, opts LoadOptions) *File {
+ if len(opts.KeyValueDelimiters) == 0 {
+ opts.KeyValueDelimiters = "=:"
+ }
+ if len(opts.KeyValueDelimiterOnWrite) == 0 {
+ opts.KeyValueDelimiterOnWrite = "="
+ }
+ if len(opts.ChildSectionDelimiter) == 0 {
+ opts.ChildSectionDelimiter = "."
+ }
+
+ return &File{
+ BlockMode: true,
+ dataSources: dataSources,
+ sections: make(map[string][]*Section),
+ options: opts,
+ }
+}
+
+// Empty returns an empty file object.
+func Empty(opts ...LoadOptions) *File {
+ var opt LoadOptions
+ if len(opts) > 0 {
+ opt = opts[0]
+ }
+
+ // Ignore error here, we are sure our data is good.
+ f, _ := LoadSources(opt, []byte(""))
+ return f
+}
+
+// NewSection creates a new section.
+func (f *File) NewSection(name string) (*Section, error) {
+ if len(name) == 0 {
+ return nil, errors.New("empty section name")
+ }
+
+ if (f.options.Insensitive || f.options.InsensitiveSections) && name != DefaultSection {
+ name = strings.ToLower(name)
+ }
+
+ if f.BlockMode {
+ f.lock.Lock()
+ defer f.lock.Unlock()
+ }
+
+ if !f.options.AllowNonUniqueSections && inSlice(name, f.sectionList) {
+ return f.sections[name][0], nil
+ }
+
+ f.sectionList = append(f.sectionList, name)
+
+ // NOTE: Append to indexes must happen before appending to sections,
+ // otherwise index will have off-by-one problem.
+ f.sectionIndexes = append(f.sectionIndexes, len(f.sections[name]))
+
+ sec := newSection(f, name)
+ f.sections[name] = append(f.sections[name], sec)
+
+ return sec, nil
+}
+
+// NewRawSection creates a new section with an unparseable body.
+func (f *File) NewRawSection(name, body string) (*Section, error) {
+ section, err := f.NewSection(name)
+ if err != nil {
+ return nil, err
+ }
+
+ section.isRawSection = true
+ section.rawBody = body
+ return section, nil
+}
+
+// NewSections creates a list of sections.
+func (f *File) NewSections(names ...string) (err error) {
+ for _, name := range names {
+ if _, err = f.NewSection(name); err != nil {
+ return err
+ }
+ }
+ return nil
+}
+
+// GetSection returns section by given name.
+func (f *File) GetSection(name string) (*Section, error) {
+ secs, err := f.SectionsByName(name)
+ if err != nil {
+ return nil, err
+ }
+
+ return secs[0], err
+}
+
+// HasSection returns true if the file contains a section with given name.
+func (f *File) HasSection(name string) bool {
+ section, _ := f.GetSection(name)
+ return section != nil
+}
+
+// SectionsByName returns all sections with given name.
+func (f *File) SectionsByName(name string) ([]*Section, error) {
+ if len(name) == 0 {
+ name = DefaultSection
+ }
+ if f.options.Insensitive || f.options.InsensitiveSections {
+ name = strings.ToLower(name)
+ }
+
+ if f.BlockMode {
+ f.lock.RLock()
+ defer f.lock.RUnlock()
+ }
+
+ secs := f.sections[name]
+ if len(secs) == 0 {
+ return nil, fmt.Errorf("section %q does not exist", name)
+ }
+
+ return secs, nil
+}
+
+// Section assumes named section exists and returns a zero-value when not.
+func (f *File) Section(name string) *Section {
+ sec, err := f.GetSection(name)
+ if err != nil {
+ if name == "" {
+ name = DefaultSection
+ }
+ sec, _ = f.NewSection(name)
+ return sec
+ }
+ return sec
+}
+
+// SectionWithIndex assumes named section exists and returns a new section when not.
+func (f *File) SectionWithIndex(name string, index int) *Section {
+ secs, err := f.SectionsByName(name)
+ if err != nil || len(secs) <= index {
+ // NOTE: It's OK here because the only possible error is empty section name,
+ // but if it's empty, this piece of code won't be executed.
+ newSec, _ := f.NewSection(name)
+ return newSec
+ }
+
+ return secs[index]
+}
+
+// Sections returns a list of Section stored in the current instance.
+func (f *File) Sections() []*Section {
+ if f.BlockMode {
+ f.lock.RLock()
+ defer f.lock.RUnlock()
+ }
+
+ sections := make([]*Section, len(f.sectionList))
+ for i, name := range f.sectionList {
+ sections[i] = f.sections[name][f.sectionIndexes[i]]
+ }
+ return sections
+}
+
+// ChildSections returns a list of child sections of given section name.
+func (f *File) ChildSections(name string) []*Section {
+ return f.Section(name).ChildSections()
+}
+
+// SectionStrings returns list of section names.
+func (f *File) SectionStrings() []string {
+ list := make([]string, len(f.sectionList))
+ copy(list, f.sectionList)
+ return list
+}
+
+// DeleteSection deletes a section or all sections with given name.
+func (f *File) DeleteSection(name string) {
+ secs, err := f.SectionsByName(name)
+ if err != nil {
+ return
+ }
+
+ for i := 0; i < len(secs); i++ {
+ // For non-unique sections, it is always needed to remove the first one so
+ // in the next iteration, the subsequent section continue having index 0.
+ // Ignoring the error as index 0 never returns an error.
+ _ = f.DeleteSectionWithIndex(name, 0)
+ }
+}
+
+// DeleteSectionWithIndex deletes a section with given name and index.
+func (f *File) DeleteSectionWithIndex(name string, index int) error {
+ if !f.options.AllowNonUniqueSections && index != 0 {
+ return fmt.Errorf("delete section with non-zero index is only allowed when non-unique sections is enabled")
+ }
+
+ if len(name) == 0 {
+ name = DefaultSection
+ }
+ if f.options.Insensitive || f.options.InsensitiveSections {
+ name = strings.ToLower(name)
+ }
+
+ if f.BlockMode {
+ f.lock.Lock()
+ defer f.lock.Unlock()
+ }
+
+ // Count occurrences of the sections
+ occurrences := 0
+
+ sectionListCopy := make([]string, len(f.sectionList))
+ copy(sectionListCopy, f.sectionList)
+
+ for i, s := range sectionListCopy {
+ if s != name {
+ continue
+ }
+
+ if occurrences == index {
+ if len(f.sections[name]) <= 1 {
+ delete(f.sections, name) // The last one in the map
+ } else {
+ f.sections[name] = append(f.sections[name][:index], f.sections[name][index+1:]...)
+ }
+
+ // Fix section lists
+ f.sectionList = append(f.sectionList[:i], f.sectionList[i+1:]...)
+ f.sectionIndexes = append(f.sectionIndexes[:i], f.sectionIndexes[i+1:]...)
+
+ } else if occurrences > index {
+ // Fix the indices of all following sections with this name.
+ f.sectionIndexes[i-1]--
+ }
+
+ occurrences++
+ }
+
+ return nil
+}
+
+func (f *File) reload(s dataSource) error {
+ r, err := s.ReadCloser()
+ if err != nil {
+ return err
+ }
+ defer r.Close()
+
+ return f.parse(r)
+}
+
+// Reload reloads and parses all data sources.
+func (f *File) Reload() (err error) {
+ for _, s := range f.dataSources {
+ if err = f.reload(s); err != nil {
+ // In loose mode, we create an empty default section for nonexistent files.
+ if os.IsNotExist(err) && f.options.Loose {
+ _ = f.parse(bytes.NewBuffer(nil))
+ continue
+ }
+ return err
+ }
+ if f.options.ShortCircuit {
+ return nil
+ }
+ }
+ return nil
+}
+
+// Append appends one or more data sources and reloads automatically.
+func (f *File) Append(source interface{}, others ...interface{}) error {
+ ds, err := parseDataSource(source)
+ if err != nil {
+ return err
+ }
+ f.dataSources = append(f.dataSources, ds)
+ for _, s := range others {
+ ds, err = parseDataSource(s)
+ if err != nil {
+ return err
+ }
+ f.dataSources = append(f.dataSources, ds)
+ }
+ return f.Reload()
+}
+
+func (f *File) writeToBuffer(indent string) (*bytes.Buffer, error) {
+ equalSign := DefaultFormatLeft + f.options.KeyValueDelimiterOnWrite + DefaultFormatRight
+
+ if PrettyFormat || PrettyEqual {
+ equalSign = fmt.Sprintf(" %s ", f.options.KeyValueDelimiterOnWrite)
+ }
+
+ // Use buffer to make sure target is safe until finish encoding.
+ buf := bytes.NewBuffer(nil)
+ lastSectionIdx := len(f.sectionList) - 1
+ for i, sname := range f.sectionList {
+ sec := f.SectionWithIndex(sname, f.sectionIndexes[i])
+ if len(sec.Comment) > 0 {
+ // Support multiline comments
+ lines := strings.Split(sec.Comment, LineBreak)
+ for i := range lines {
+ if lines[i][0] != '#' && lines[i][0] != ';' {
+ lines[i] = "; " + lines[i]
+ } else {
+ lines[i] = lines[i][:1] + " " + strings.TrimSpace(lines[i][1:])
+ }
+
+ if _, err := buf.WriteString(lines[i] + LineBreak); err != nil {
+ return nil, err
+ }
+ }
+ }
+
+ if i > 0 || DefaultHeader || (i == 0 && strings.ToUpper(sec.name) != DefaultSection) {
+ if _, err := buf.WriteString("[" + sname + "]" + LineBreak); err != nil {
+ return nil, err
+ }
+ } else {
+ // Write nothing if default section is empty
+ if len(sec.keyList) == 0 {
+ continue
+ }
+ }
+
+ isLastSection := i == lastSectionIdx
+ if sec.isRawSection {
+ if _, err := buf.WriteString(sec.rawBody); err != nil {
+ return nil, err
+ }
+
+ if PrettySection && !isLastSection {
+ // Put a line between sections
+ if _, err := buf.WriteString(LineBreak); err != nil {
+ return nil, err
+ }
+ }
+ continue
+ }
+
+ // Count and generate alignment length and buffer spaces using the
+ // longest key. Keys may be modified if they contain certain characters so
+ // we need to take that into account in our calculation.
+ alignLength := 0
+ if PrettyFormat {
+ for _, kname := range sec.keyList {
+ keyLength := len(kname)
+ // First case will surround key by ` and second by """
+ if strings.Contains(kname, "\"") || strings.ContainsAny(kname, f.options.KeyValueDelimiters) {
+ keyLength += 2
+ } else if strings.Contains(kname, "`") {
+ keyLength += 6
+ }
+
+ if keyLength > alignLength {
+ alignLength = keyLength
+ }
+ }
+ }
+ alignSpaces := bytes.Repeat([]byte(" "), alignLength)
+
+ KeyList:
+ for _, kname := range sec.keyList {
+ key := sec.Key(kname)
+ if len(key.Comment) > 0 {
+ if len(indent) > 0 && sname != DefaultSection {
+ buf.WriteString(indent)
+ }
+
+ // Support multiline comments
+ lines := strings.Split(key.Comment, LineBreak)
+ for i := range lines {
+ if lines[i][0] != '#' && lines[i][0] != ';' {
+ lines[i] = "; " + strings.TrimSpace(lines[i])
+ } else {
+ lines[i] = lines[i][:1] + " " + strings.TrimSpace(lines[i][1:])
+ }
+
+ if _, err := buf.WriteString(lines[i] + LineBreak); err != nil {
+ return nil, err
+ }
+ }
+ }
+
+ if len(indent) > 0 && sname != DefaultSection {
+ buf.WriteString(indent)
+ }
+
+ switch {
+ case key.isAutoIncrement:
+ kname = "-"
+ case strings.Contains(kname, "\"") || strings.ContainsAny(kname, f.options.KeyValueDelimiters):
+ kname = "`" + kname + "`"
+ case strings.Contains(kname, "`"):
+ kname = `"""` + kname + `"""`
+ }
+
+ writeKeyValue := func(val string) (bool, error) {
+ if _, err := buf.WriteString(kname); err != nil {
+ return false, err
+ }
+
+ if key.isBooleanType {
+ buf.WriteString(LineBreak)
+ return true, nil
+ }
+
+ // Write out alignment spaces before "=" sign
+ if PrettyFormat {
+ buf.Write(alignSpaces[:alignLength-len(kname)])
+ }
+
+ // In case key value contains "\n", "`", "\"", "#" or ";"
+ if strings.ContainsAny(val, "\n`") {
+ val = `"""` + val + `"""`
+ } else if !f.options.IgnoreInlineComment && strings.ContainsAny(val, "#;") {
+ val = "`" + val + "`"
+ } else if len(strings.TrimSpace(val)) != len(val) {
+ val = `"` + val + `"`
+ }
+ if _, err := buf.WriteString(equalSign + val + LineBreak); err != nil {
+ return false, err
+ }
+ return false, nil
+ }
+
+ shadows := key.ValueWithShadows()
+ if len(shadows) == 0 {
+ if _, err := writeKeyValue(""); err != nil {
+ return nil, err
+ }
+ }
+
+ for _, val := range shadows {
+ exitLoop, err := writeKeyValue(val)
+ if err != nil {
+ return nil, err
+ } else if exitLoop {
+ continue KeyList
+ }
+ }
+
+ for _, val := range key.nestedValues {
+ if _, err := buf.WriteString(indent + " " + val + LineBreak); err != nil {
+ return nil, err
+ }
+ }
+ }
+
+ if PrettySection && !isLastSection {
+ // Put a line between sections
+ if _, err := buf.WriteString(LineBreak); err != nil {
+ return nil, err
+ }
+ }
+ }
+
+ return buf, nil
+}
+
+// WriteToIndent writes content into io.Writer with given indention.
+// If PrettyFormat has been set to be true,
+// it will align "=" sign with spaces under each section.
+func (f *File) WriteToIndent(w io.Writer, indent string) (int64, error) {
+ buf, err := f.writeToBuffer(indent)
+ if err != nil {
+ return 0, err
+ }
+ return buf.WriteTo(w)
+}
+
+// WriteTo writes file content into io.Writer.
+func (f *File) WriteTo(w io.Writer) (int64, error) {
+ return f.WriteToIndent(w, "")
+}
+
+// SaveToIndent writes content to file system with given value indention.
+func (f *File) SaveToIndent(filename, indent string) error {
+ // Note: Because we are truncating with os.Create,
+ // so it's safer to save to a temporary file location and rename after done.
+ buf, err := f.writeToBuffer(indent)
+ if err != nil {
+ return err
+ }
+
+ return ioutil.WriteFile(filename, buf.Bytes(), 0666)
+}
+
+// SaveTo writes content to file system.
+func (f *File) SaveTo(filename string) error {
+ return f.SaveToIndent(filename, "")
+}
diff --git a/vendor/gopkg.in/ini.v1/helper.go b/vendor/gopkg.in/ini.v1/helper.go
@@ -0,0 +1,24 @@
+// Copyright 2019 Unknwon
+//
+// Licensed under the Apache License, Version 2.0 (the "License"): you may
+// not use this file except in compliance with the License. You may obtain
+// a copy of the License at
+//
+// http://www.apache.org/licenses/LICENSE-2.0
+//
+// Unless required by applicable law or agreed to in writing, software
+// distributed under the License is distributed on an "AS IS" BASIS, WITHOUT
+// WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the
+// License for the specific language governing permissions and limitations
+// under the License.
+
+package ini
+
+func inSlice(str string, s []string) bool {
+ for _, v := range s {
+ if str == v {
+ return true
+ }
+ }
+ return false
+}
diff --git a/vendor/gopkg.in/ini.v1/ini.go b/vendor/gopkg.in/ini.v1/ini.go
@@ -0,0 +1,176 @@
+// Copyright 2014 Unknwon
+//
+// Licensed under the Apache License, Version 2.0 (the "License"): you may
+// not use this file except in compliance with the License. You may obtain
+// a copy of the License at
+//
+// http://www.apache.org/licenses/LICENSE-2.0
+//
+// Unless required by applicable law or agreed to in writing, software
+// distributed under the License is distributed on an "AS IS" BASIS, WITHOUT
+// WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the
+// License for the specific language governing permissions and limitations
+// under the License.
+
+// Package ini provides INI file read and write functionality in Go.
+package ini
+
+import (
+ "os"
+ "regexp"
+ "runtime"
+ "strings"
+)
+
+const (
+ // Maximum allowed depth when recursively substituing variable names.
+ depthValues = 99
+)
+
+var (
+ // DefaultSection is the name of default section. You can use this var or the string literal.
+ // In most of cases, an empty string is all you need to access the section.
+ DefaultSection = "DEFAULT"
+
+ // LineBreak is the delimiter to determine or compose a new line.
+ // This variable will be changed to "\r\n" automatically on Windows at package init time.
+ LineBreak = "\n"
+
+ // Variable regexp pattern: %(variable)s
+ varPattern = regexp.MustCompile(`%\(([^)]+)\)s`)
+
+ // DefaultHeader explicitly writes default section header.
+ DefaultHeader = false
+
+ // PrettySection indicates whether to put a line between sections.
+ PrettySection = true
+ // PrettyFormat indicates whether to align "=" sign with spaces to produce pretty output
+ // or reduce all possible spaces for compact format.
+ PrettyFormat = true
+ // PrettyEqual places spaces around "=" sign even when PrettyFormat is false.
+ PrettyEqual = false
+ // DefaultFormatLeft places custom spaces on the left when PrettyFormat and PrettyEqual are both disabled.
+ DefaultFormatLeft = ""
+ // DefaultFormatRight places custom spaces on the right when PrettyFormat and PrettyEqual are both disabled.
+ DefaultFormatRight = ""
+)
+
+var inTest = len(os.Args) > 0 && strings.HasSuffix(strings.TrimSuffix(os.Args[0], ".exe"), ".test")
+
+func init() {
+ if runtime.GOOS == "windows" && !inTest {
+ LineBreak = "\r\n"
+ }
+}
+
+// LoadOptions contains all customized options used for load data source(s).
+type LoadOptions struct {
+ // Loose indicates whether the parser should ignore nonexistent files or return error.
+ Loose bool
+ // Insensitive indicates whether the parser forces all section and key names to lowercase.
+ Insensitive bool
+ // InsensitiveSections indicates whether the parser forces all section to lowercase.
+ InsensitiveSections bool
+ // InsensitiveKeys indicates whether the parser forces all key names to lowercase.
+ InsensitiveKeys bool
+ // IgnoreContinuation indicates whether to ignore continuation lines while parsing.
+ IgnoreContinuation bool
+ // IgnoreInlineComment indicates whether to ignore comments at the end of value and treat it as part of value.
+ IgnoreInlineComment bool
+ // SkipUnrecognizableLines indicates whether to skip unrecognizable lines that do not conform to key/value pairs.
+ SkipUnrecognizableLines bool
+ // ShortCircuit indicates whether to ignore other configuration sources after loaded the first available configuration source.
+ ShortCircuit bool
+ // AllowBooleanKeys indicates whether to allow boolean type keys or treat as value is missing.
+ // This type of keys are mostly used in my.cnf.
+ AllowBooleanKeys bool
+ // AllowShadows indicates whether to keep track of keys with same name under same section.
+ AllowShadows bool
+ // AllowNestedValues indicates whether to allow AWS-like nested values.
+ // Docs: http://docs.aws.amazon.com/cli/latest/topic/config-vars.html#nested-values
+ AllowNestedValues bool
+ // AllowPythonMultilineValues indicates whether to allow Python-like multi-line values.
+ // Docs: https://docs.python.org/3/library/configparser.html#supported-ini-file-structure
+ // Relevant quote: Values can also span multiple lines, as long as they are indented deeper
+ // than the first line of the value.
+ AllowPythonMultilineValues bool
+ // SpaceBeforeInlineComment indicates whether to allow comment symbols (\# and \;) inside value.
+ // Docs: https://docs.python.org/2/library/configparser.html
+ // Quote: Comments may appear on their own in an otherwise empty line, or may be entered in lines holding values or section names.
+ // In the latter case, they need to be preceded by a whitespace character to be recognized as a comment.
+ SpaceBeforeInlineComment bool
+ // UnescapeValueDoubleQuotes indicates whether to unescape double quotes inside value to regular format
+ // when value is surrounded by double quotes, e.g. key="a \"value\"" => key=a "value"
+ UnescapeValueDoubleQuotes bool
+ // UnescapeValueCommentSymbols indicates to unescape comment symbols (\# and \;) inside value to regular format
+ // when value is NOT surrounded by any quotes.
+ // Note: UNSTABLE, behavior might change to only unescape inside double quotes but may noy necessary at all.
+ UnescapeValueCommentSymbols bool
+ // UnparseableSections stores a list of blocks that are allowed with raw content which do not otherwise
+ // conform to key/value pairs. Specify the names of those blocks here.
+ UnparseableSections []string
+ // KeyValueDelimiters is the sequence of delimiters that are used to separate key and value. By default, it is "=:".
+ KeyValueDelimiters string
+ // KeyValueDelimiterOnWrite is the delimiter that are used to separate key and value output. By default, it is "=".
+ KeyValueDelimiterOnWrite string
+ // ChildSectionDelimiter is the delimiter that is used to separate child sections. By default, it is ".".
+ ChildSectionDelimiter string
+ // PreserveSurroundedQuote indicates whether to preserve surrounded quote (single and double quotes).
+ PreserveSurroundedQuote bool
+ // DebugFunc is called to collect debug information (currently only useful to debug parsing Python-style multiline values).
+ DebugFunc DebugFunc
+ // ReaderBufferSize is the buffer size of the reader in bytes.
+ ReaderBufferSize int
+ // AllowNonUniqueSections indicates whether to allow sections with the same name multiple times.
+ AllowNonUniqueSections bool
+ // AllowDuplicateShadowValues indicates whether values for shadowed keys should be deduplicated.
+ AllowDuplicateShadowValues bool
+}
+
+// DebugFunc is the type of function called to log parse events.
+type DebugFunc func(message string)
+
+// LoadSources allows caller to apply customized options for loading from data source(s).
+func LoadSources(opts LoadOptions, source interface{}, others ...interface{}) (_ *File, err error) {
+ sources := make([]dataSource, len(others)+1)
+ sources[0], err = parseDataSource(source)
+ if err != nil {
+ return nil, err
+ }
+ for i := range others {
+ sources[i+1], err = parseDataSource(others[i])
+ if err != nil {
+ return nil, err
+ }
+ }
+ f := newFile(sources, opts)
+ if err = f.Reload(); err != nil {
+ return nil, err
+ }
+ return f, nil
+}
+
+// Load loads and parses from INI data sources.
+// Arguments can be mixed of file name with string type, or raw data in []byte.
+// It will return error if list contains nonexistent files.
+func Load(source interface{}, others ...interface{}) (*File, error) {
+ return LoadSources(LoadOptions{}, source, others...)
+}
+
+// LooseLoad has exactly same functionality as Load function
+// except it ignores nonexistent files instead of returning error.
+func LooseLoad(source interface{}, others ...interface{}) (*File, error) {
+ return LoadSources(LoadOptions{Loose: true}, source, others...)
+}
+
+// InsensitiveLoad has exactly same functionality as Load function
+// except it forces all section and key names to be lowercased.
+func InsensitiveLoad(source interface{}, others ...interface{}) (*File, error) {
+ return LoadSources(LoadOptions{Insensitive: true}, source, others...)
+}
+
+// ShadowLoad has exactly same functionality as Load function
+// except it allows have shadow keys.
+func ShadowLoad(source interface{}, others ...interface{}) (*File, error) {
+ return LoadSources(LoadOptions{AllowShadows: true}, source, others...)
+}
diff --git a/vendor/gopkg.in/ini.v1/key.go b/vendor/gopkg.in/ini.v1/key.go
@@ -0,0 +1,837 @@
+// Copyright 2014 Unknwon
+//
+// Licensed under the Apache License, Version 2.0 (the "License"): you may
+// not use this file except in compliance with the License. You may obtain
+// a copy of the License at
+//
+// http://www.apache.org/licenses/LICENSE-2.0
+//
+// Unless required by applicable law or agreed to in writing, software
+// distributed under the License is distributed on an "AS IS" BASIS, WITHOUT
+// WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the
+// License for the specific language governing permissions and limitations
+// under the License.
+
+package ini
+
+import (
+ "bytes"
+ "errors"
+ "fmt"
+ "strconv"
+ "strings"
+ "time"
+)
+
+// Key represents a key under a section.
+type Key struct {
+ s *Section
+ Comment string
+ name string
+ value string
+ isAutoIncrement bool
+ isBooleanType bool
+
+ isShadow bool
+ shadows []*Key
+
+ nestedValues []string
+}
+
+// newKey simply return a key object with given values.
+func newKey(s *Section, name, val string) *Key {
+ return &Key{
+ s: s,
+ name: name,
+ value: val,
+ }
+}
+
+func (k *Key) addShadow(val string) error {
+ if k.isShadow {
+ return errors.New("cannot add shadow to another shadow key")
+ } else if k.isAutoIncrement || k.isBooleanType {
+ return errors.New("cannot add shadow to auto-increment or boolean key")
+ }
+
+ if !k.s.f.options.AllowDuplicateShadowValues {
+ // Deduplicate shadows based on their values.
+ if k.value == val {
+ return nil
+ }
+ for i := range k.shadows {
+ if k.shadows[i].value == val {
+ return nil
+ }
+ }
+ }
+
+ shadow := newKey(k.s, k.name, val)
+ shadow.isShadow = true
+ k.shadows = append(k.shadows, shadow)
+ return nil
+}
+
+// AddShadow adds a new shadow key to itself.
+func (k *Key) AddShadow(val string) error {
+ if !k.s.f.options.AllowShadows {
+ return errors.New("shadow key is not allowed")
+ }
+ return k.addShadow(val)
+}
+
+func (k *Key) addNestedValue(val string) error {
+ if k.isAutoIncrement || k.isBooleanType {
+ return errors.New("cannot add nested value to auto-increment or boolean key")
+ }
+
+ k.nestedValues = append(k.nestedValues, val)
+ return nil
+}
+
+// AddNestedValue adds a nested value to the key.
+func (k *Key) AddNestedValue(val string) error {
+ if !k.s.f.options.AllowNestedValues {
+ return errors.New("nested value is not allowed")
+ }
+ return k.addNestedValue(val)
+}
+
+// ValueMapper represents a mapping function for values, e.g. os.ExpandEnv
+type ValueMapper func(string) string
+
+// Name returns name of key.
+func (k *Key) Name() string {
+ return k.name
+}
+
+// Value returns raw value of key for performance purpose.
+func (k *Key) Value() string {
+ return k.value
+}
+
+// ValueWithShadows returns raw values of key and its shadows if any. Shadow
+// keys with empty values are ignored from the returned list.
+func (k *Key) ValueWithShadows() []string {
+ if len(k.shadows) == 0 {
+ if k.value == "" {
+ return []string{}
+ }
+ return []string{k.value}
+ }
+
+ vals := make([]string, 0, len(k.shadows)+1)
+ if k.value != "" {
+ vals = append(vals, k.value)
+ }
+ for _, s := range k.shadows {
+ if s.value != "" {
+ vals = append(vals, s.value)
+ }
+ }
+ return vals
+}
+
+// NestedValues returns nested values stored in the key.
+// It is possible returned value is nil if no nested values stored in the key.
+func (k *Key) NestedValues() []string {
+ return k.nestedValues
+}
+
+// transformValue takes a raw value and transforms to its final string.
+func (k *Key) transformValue(val string) string {
+ if k.s.f.ValueMapper != nil {
+ val = k.s.f.ValueMapper(val)
+ }
+
+ // Fail-fast if no indicate char found for recursive value
+ if !strings.Contains(val, "%") {
+ return val
+ }
+ for i := 0; i < depthValues; i++ {
+ vr := varPattern.FindString(val)
+ if len(vr) == 0 {
+ break
+ }
+
+ // Take off leading '%(' and trailing ')s'.
+ noption := vr[2 : len(vr)-2]
+
+ // Search in the same section.
+ // If not found or found the key itself, then search again in default section.
+ nk, err := k.s.GetKey(noption)
+ if err != nil || k == nk {
+ nk, _ = k.s.f.Section("").GetKey(noption)
+ if nk == nil {
+ // Stop when no results found in the default section,
+ // and returns the value as-is.
+ break
+ }
+ }
+
+ // Substitute by new value and take off leading '%(' and trailing ')s'.
+ val = strings.ReplaceAll(val, vr, nk.value)
+ }
+ return val
+}
+
+// String returns string representation of value.
+func (k *Key) String() string {
+ return k.transformValue(k.value)
+}
+
+// Validate accepts a validate function which can
+// return modifed result as key value.
+func (k *Key) Validate(fn func(string) string) string {
+ return fn(k.String())
+}
+
+// parseBool returns the boolean value represented by the string.
+//
+// It accepts 1, t, T, TRUE, true, True, YES, yes, Yes, y, ON, on, On,
+// 0, f, F, FALSE, false, False, NO, no, No, n, OFF, off, Off.
+// Any other value returns an error.
+func parseBool(str string) (value bool, err error) {
+ switch str {
+ case "1", "t", "T", "true", "TRUE", "True", "YES", "yes", "Yes", "y", "ON", "on", "On":
+ return true, nil
+ case "0", "f", "F", "false", "FALSE", "False", "NO", "no", "No", "n", "OFF", "off", "Off":
+ return false, nil
+ }
+ return false, fmt.Errorf("parsing \"%s\": invalid syntax", str)
+}
+
+// Bool returns bool type value.
+func (k *Key) Bool() (bool, error) {
+ return parseBool(k.String())
+}
+
+// Float64 returns float64 type value.
+func (k *Key) Float64() (float64, error) {
+ return strconv.ParseFloat(k.String(), 64)
+}
+
+// Int returns int type value.
+func (k *Key) Int() (int, error) {
+ v, err := strconv.ParseInt(k.String(), 0, 64)
+ return int(v), err
+}
+
+// Int64 returns int64 type value.
+func (k *Key) Int64() (int64, error) {
+ return strconv.ParseInt(k.String(), 0, 64)
+}
+
+// Uint returns uint type valued.
+func (k *Key) Uint() (uint, error) {
+ u, e := strconv.ParseUint(k.String(), 0, 64)
+ return uint(u), e
+}
+
+// Uint64 returns uint64 type value.
+func (k *Key) Uint64() (uint64, error) {
+ return strconv.ParseUint(k.String(), 0, 64)
+}
+
+// Duration returns time.Duration type value.
+func (k *Key) Duration() (time.Duration, error) {
+ return time.ParseDuration(k.String())
+}
+
+// TimeFormat parses with given format and returns time.Time type value.
+func (k *Key) TimeFormat(format string) (time.Time, error) {
+ return time.Parse(format, k.String())
+}
+
+// Time parses with RFC3339 format and returns time.Time type value.
+func (k *Key) Time() (time.Time, error) {
+ return k.TimeFormat(time.RFC3339)
+}
+
+// MustString returns default value if key value is empty.
+func (k *Key) MustString(defaultVal string) string {
+ val := k.String()
+ if len(val) == 0 {
+ k.value = defaultVal
+ return defaultVal
+ }
+ return val
+}
+
+// MustBool always returns value without error,
+// it returns false if error occurs.
+func (k *Key) MustBool(defaultVal ...bool) bool {
+ val, err := k.Bool()
+ if len(defaultVal) > 0 && err != nil {
+ k.value = strconv.FormatBool(defaultVal[0])
+ return defaultVal[0]
+ }
+ return val
+}
+
+// MustFloat64 always returns value without error,
+// it returns 0.0 if error occurs.
+func (k *Key) MustFloat64(defaultVal ...float64) float64 {
+ val, err := k.Float64()
+ if len(defaultVal) > 0 && err != nil {
+ k.value = strconv.FormatFloat(defaultVal[0], 'f', -1, 64)
+ return defaultVal[0]
+ }
+ return val
+}
+
+// MustInt always returns value without error,
+// it returns 0 if error occurs.
+func (k *Key) MustInt(defaultVal ...int) int {
+ val, err := k.Int()
+ if len(defaultVal) > 0 && err != nil {
+ k.value = strconv.FormatInt(int64(defaultVal[0]), 10)
+ return defaultVal[0]
+ }
+ return val
+}
+
+// MustInt64 always returns value without error,
+// it returns 0 if error occurs.
+func (k *Key) MustInt64(defaultVal ...int64) int64 {
+ val, err := k.Int64()
+ if len(defaultVal) > 0 && err != nil {
+ k.value = strconv.FormatInt(defaultVal[0], 10)
+ return defaultVal[0]
+ }
+ return val
+}
+
+// MustUint always returns value without error,
+// it returns 0 if error occurs.
+func (k *Key) MustUint(defaultVal ...uint) uint {
+ val, err := k.Uint()
+ if len(defaultVal) > 0 && err != nil {
+ k.value = strconv.FormatUint(uint64(defaultVal[0]), 10)
+ return defaultVal[0]
+ }
+ return val
+}
+
+// MustUint64 always returns value without error,
+// it returns 0 if error occurs.
+func (k *Key) MustUint64(defaultVal ...uint64) uint64 {
+ val, err := k.Uint64()
+ if len(defaultVal) > 0 && err != nil {
+ k.value = strconv.FormatUint(defaultVal[0], 10)
+ return defaultVal[0]
+ }
+ return val
+}
+
+// MustDuration always returns value without error,
+// it returns zero value if error occurs.
+func (k *Key) MustDuration(defaultVal ...time.Duration) time.Duration {
+ val, err := k.Duration()
+ if len(defaultVal) > 0 && err != nil {
+ k.value = defaultVal[0].String()
+ return defaultVal[0]
+ }
+ return val
+}
+
+// MustTimeFormat always parses with given format and returns value without error,
+// it returns zero value if error occurs.
+func (k *Key) MustTimeFormat(format string, defaultVal ...time.Time) time.Time {
+ val, err := k.TimeFormat(format)
+ if len(defaultVal) > 0 && err != nil {
+ k.value = defaultVal[0].Format(format)
+ return defaultVal[0]
+ }
+ return val
+}
+
+// MustTime always parses with RFC3339 format and returns value without error,
+// it returns zero value if error occurs.
+func (k *Key) MustTime(defaultVal ...time.Time) time.Time {
+ return k.MustTimeFormat(time.RFC3339, defaultVal...)
+}
+
+// In always returns value without error,
+// it returns default value if error occurs or doesn't fit into candidates.
+func (k *Key) In(defaultVal string, candidates []string) string {
+ val := k.String()
+ for _, cand := range candidates {
+ if val == cand {
+ return val
+ }
+ }
+ return defaultVal
+}
+
+// InFloat64 always returns value without error,
+// it returns default value if error occurs or doesn't fit into candidates.
+func (k *Key) InFloat64(defaultVal float64, candidates []float64) float64 {
+ val := k.MustFloat64()
+ for _, cand := range candidates {
+ if val == cand {
+ return val
+ }
+ }
+ return defaultVal
+}
+
+// InInt always returns value without error,
+// it returns default value if error occurs or doesn't fit into candidates.
+func (k *Key) InInt(defaultVal int, candidates []int) int {
+ val := k.MustInt()
+ for _, cand := range candidates {
+ if val == cand {
+ return val
+ }
+ }
+ return defaultVal
+}
+
+// InInt64 always returns value without error,
+// it returns default value if error occurs or doesn't fit into candidates.
+func (k *Key) InInt64(defaultVal int64, candidates []int64) int64 {
+ val := k.MustInt64()
+ for _, cand := range candidates {
+ if val == cand {
+ return val
+ }
+ }
+ return defaultVal
+}
+
+// InUint always returns value without error,
+// it returns default value if error occurs or doesn't fit into candidates.
+func (k *Key) InUint(defaultVal uint, candidates []uint) uint {
+ val := k.MustUint()
+ for _, cand := range candidates {
+ if val == cand {
+ return val
+ }
+ }
+ return defaultVal
+}
+
+// InUint64 always returns value without error,
+// it returns default value if error occurs or doesn't fit into candidates.
+func (k *Key) InUint64(defaultVal uint64, candidates []uint64) uint64 {
+ val := k.MustUint64()
+ for _, cand := range candidates {
+ if val == cand {
+ return val
+ }
+ }
+ return defaultVal
+}
+
+// InTimeFormat always parses with given format and returns value without error,
+// it returns default value if error occurs or doesn't fit into candidates.
+func (k *Key) InTimeFormat(format string, defaultVal time.Time, candidates []time.Time) time.Time {
+ val := k.MustTimeFormat(format)
+ for _, cand := range candidates {
+ if val.Equal(cand) {
+ return val
+ }
+ }
+ return defaultVal
+}
+
+// InTime always parses with RFC3339 format and returns value without error,
+// it returns default value if error occurs or doesn't fit into candidates.
+func (k *Key) InTime(defaultVal time.Time, candidates []time.Time) time.Time {
+ return k.InTimeFormat(time.RFC3339, defaultVal, candidates)
+}
+
+// RangeFloat64 checks if value is in given range inclusively,
+// and returns default value if it's not.
+func (k *Key) RangeFloat64(defaultVal, min, max float64) float64 {
+ val := k.MustFloat64()
+ if val < min || val > max {
+ return defaultVal
+ }
+ return val
+}
+
+// RangeInt checks if value is in given range inclusively,
+// and returns default value if it's not.
+func (k *Key) RangeInt(defaultVal, min, max int) int {
+ val := k.MustInt()
+ if val < min || val > max {
+ return defaultVal
+ }
+ return val
+}
+
+// RangeInt64 checks if value is in given range inclusively,
+// and returns default value if it's not.
+func (k *Key) RangeInt64(defaultVal, min, max int64) int64 {
+ val := k.MustInt64()
+ if val < min || val > max {
+ return defaultVal
+ }
+ return val
+}
+
+// RangeTimeFormat checks if value with given format is in given range inclusively,
+// and returns default value if it's not.
+func (k *Key) RangeTimeFormat(format string, defaultVal, min, max time.Time) time.Time {
+ val := k.MustTimeFormat(format)
+ if val.Unix() < min.Unix() || val.Unix() > max.Unix() {
+ return defaultVal
+ }
+ return val
+}
+
+// RangeTime checks if value with RFC3339 format is in given range inclusively,
+// and returns default value if it's not.
+func (k *Key) RangeTime(defaultVal, min, max time.Time) time.Time {
+ return k.RangeTimeFormat(time.RFC3339, defaultVal, min, max)
+}
+
+// Strings returns list of string divided by given delimiter.
+func (k *Key) Strings(delim string) []string {
+ str := k.String()
+ if len(str) == 0 {
+ return []string{}
+ }
+
+ runes := []rune(str)
+ vals := make([]string, 0, 2)
+ var buf bytes.Buffer
+ escape := false
+ idx := 0
+ for {
+ if escape {
+ escape = false
+ if runes[idx] != '\\' && !strings.HasPrefix(string(runes[idx:]), delim) {
+ buf.WriteRune('\\')
+ }
+ buf.WriteRune(runes[idx])
+ } else {
+ if runes[idx] == '\\' {
+ escape = true
+ } else if strings.HasPrefix(string(runes[idx:]), delim) {
+ idx += len(delim) - 1
+ vals = append(vals, strings.TrimSpace(buf.String()))
+ buf.Reset()
+ } else {
+ buf.WriteRune(runes[idx])
+ }
+ }
+ idx++
+ if idx == len(runes) {
+ break
+ }
+ }
+
+ if buf.Len() > 0 {
+ vals = append(vals, strings.TrimSpace(buf.String()))
+ }
+
+ return vals
+}
+
+// StringsWithShadows returns list of string divided by given delimiter.
+// Shadows will also be appended if any.
+func (k *Key) StringsWithShadows(delim string) []string {
+ vals := k.ValueWithShadows()
+ results := make([]string, 0, len(vals)*2)
+ for i := range vals {
+ if len(vals) == 0 {
+ continue
+ }
+
+ results = append(results, strings.Split(vals[i], delim)...)
+ }
+
+ for i := range results {
+ results[i] = k.transformValue(strings.TrimSpace(results[i]))
+ }
+ return results
+}
+
+// Float64s returns list of float64 divided by given delimiter. Any invalid input will be treated as zero value.
+func (k *Key) Float64s(delim string) []float64 {
+ vals, _ := k.parseFloat64s(k.Strings(delim), true, false)
+ return vals
+}
+
+// Ints returns list of int divided by given delimiter. Any invalid input will be treated as zero value.
+func (k *Key) Ints(delim string) []int {
+ vals, _ := k.parseInts(k.Strings(delim), true, false)
+ return vals
+}
+
+// Int64s returns list of int64 divided by given delimiter. Any invalid input will be treated as zero value.
+func (k *Key) Int64s(delim string) []int64 {
+ vals, _ := k.parseInt64s(k.Strings(delim), true, false)
+ return vals
+}
+
+// Uints returns list of uint divided by given delimiter. Any invalid input will be treated as zero value.
+func (k *Key) Uints(delim string) []uint {
+ vals, _ := k.parseUints(k.Strings(delim), true, false)
+ return vals
+}
+
+// Uint64s returns list of uint64 divided by given delimiter. Any invalid input will be treated as zero value.
+func (k *Key) Uint64s(delim string) []uint64 {
+ vals, _ := k.parseUint64s(k.Strings(delim), true, false)
+ return vals
+}
+
+// Bools returns list of bool divided by given delimiter. Any invalid input will be treated as zero value.
+func (k *Key) Bools(delim string) []bool {
+ vals, _ := k.parseBools(k.Strings(delim), true, false)
+ return vals
+}
+
+// TimesFormat parses with given format and returns list of time.Time divided by given delimiter.
+// Any invalid input will be treated as zero value (0001-01-01 00:00:00 +0000 UTC).
+func (k *Key) TimesFormat(format, delim string) []time.Time {
+ vals, _ := k.parseTimesFormat(format, k.Strings(delim), true, false)
+ return vals
+}
+
+// Times parses with RFC3339 format and returns list of time.Time divided by given delimiter.
+// Any invalid input will be treated as zero value (0001-01-01 00:00:00 +0000 UTC).
+func (k *Key) Times(delim string) []time.Time {
+ return k.TimesFormat(time.RFC3339, delim)
+}
+
+// ValidFloat64s returns list of float64 divided by given delimiter. If some value is not float, then
+// it will not be included to result list.
+func (k *Key) ValidFloat64s(delim string) []float64 {
+ vals, _ := k.parseFloat64s(k.Strings(delim), false, false)
+ return vals
+}
+
+// ValidInts returns list of int divided by given delimiter. If some value is not integer, then it will
+// not be included to result list.
+func (k *Key) ValidInts(delim string) []int {
+ vals, _ := k.parseInts(k.Strings(delim), false, false)
+ return vals
+}
+
+// ValidInt64s returns list of int64 divided by given delimiter. If some value is not 64-bit integer,
+// then it will not be included to result list.
+func (k *Key) ValidInt64s(delim string) []int64 {
+ vals, _ := k.parseInt64s(k.Strings(delim), false, false)
+ return vals
+}
+
+// ValidUints returns list of uint divided by given delimiter. If some value is not unsigned integer,
+// then it will not be included to result list.
+func (k *Key) ValidUints(delim string) []uint {
+ vals, _ := k.parseUints(k.Strings(delim), false, false)
+ return vals
+}
+
+// ValidUint64s returns list of uint64 divided by given delimiter. If some value is not 64-bit unsigned
+// integer, then it will not be included to result list.
+func (k *Key) ValidUint64s(delim string) []uint64 {
+ vals, _ := k.parseUint64s(k.Strings(delim), false, false)
+ return vals
+}
+
+// ValidBools returns list of bool divided by given delimiter. If some value is not 64-bit unsigned
+// integer, then it will not be included to result list.
+func (k *Key) ValidBools(delim string) []bool {
+ vals, _ := k.parseBools(k.Strings(delim), false, false)
+ return vals
+}
+
+// ValidTimesFormat parses with given format and returns list of time.Time divided by given delimiter.
+func (k *Key) ValidTimesFormat(format, delim string) []time.Time {
+ vals, _ := k.parseTimesFormat(format, k.Strings(delim), false, false)
+ return vals
+}
+
+// ValidTimes parses with RFC3339 format and returns list of time.Time divided by given delimiter.
+func (k *Key) ValidTimes(delim string) []time.Time {
+ return k.ValidTimesFormat(time.RFC3339, delim)
+}
+
+// StrictFloat64s returns list of float64 divided by given delimiter or error on first invalid input.
+func (k *Key) StrictFloat64s(delim string) ([]float64, error) {
+ return k.parseFloat64s(k.Strings(delim), false, true)
+}
+
+// StrictInts returns list of int divided by given delimiter or error on first invalid input.
+func (k *Key) StrictInts(delim string) ([]int, error) {
+ return k.parseInts(k.Strings(delim), false, true)
+}
+
+// StrictInt64s returns list of int64 divided by given delimiter or error on first invalid input.
+func (k *Key) StrictInt64s(delim string) ([]int64, error) {
+ return k.parseInt64s(k.Strings(delim), false, true)
+}
+
+// StrictUints returns list of uint divided by given delimiter or error on first invalid input.
+func (k *Key) StrictUints(delim string) ([]uint, error) {
+ return k.parseUints(k.Strings(delim), false, true)
+}
+
+// StrictUint64s returns list of uint64 divided by given delimiter or error on first invalid input.
+func (k *Key) StrictUint64s(delim string) ([]uint64, error) {
+ return k.parseUint64s(k.Strings(delim), false, true)
+}
+
+// StrictBools returns list of bool divided by given delimiter or error on first invalid input.
+func (k *Key) StrictBools(delim string) ([]bool, error) {
+ return k.parseBools(k.Strings(delim), false, true)
+}
+
+// StrictTimesFormat parses with given format and returns list of time.Time divided by given delimiter
+// or error on first invalid input.
+func (k *Key) StrictTimesFormat(format, delim string) ([]time.Time, error) {
+ return k.parseTimesFormat(format, k.Strings(delim), false, true)
+}
+
+// StrictTimes parses with RFC3339 format and returns list of time.Time divided by given delimiter
+// or error on first invalid input.
+func (k *Key) StrictTimes(delim string) ([]time.Time, error) {
+ return k.StrictTimesFormat(time.RFC3339, delim)
+}
+
+// parseBools transforms strings to bools.
+func (k *Key) parseBools(strs []string, addInvalid, returnOnInvalid bool) ([]bool, error) {
+ vals := make([]bool, 0, len(strs))
+ parser := func(str string) (interface{}, error) {
+ val, err := parseBool(str)
+ return val, err
+ }
+ rawVals, err := k.doParse(strs, addInvalid, returnOnInvalid, parser)
+ if err == nil {
+ for _, val := range rawVals {
+ vals = append(vals, val.(bool))
+ }
+ }
+ return vals, err
+}
+
+// parseFloat64s transforms strings to float64s.
+func (k *Key) parseFloat64s(strs []string, addInvalid, returnOnInvalid bool) ([]float64, error) {
+ vals := make([]float64, 0, len(strs))
+ parser := func(str string) (interface{}, error) {
+ val, err := strconv.ParseFloat(str, 64)
+ return val, err
+ }
+ rawVals, err := k.doParse(strs, addInvalid, returnOnInvalid, parser)
+ if err == nil {
+ for _, val := range rawVals {
+ vals = append(vals, val.(float64))
+ }
+ }
+ return vals, err
+}
+
+// parseInts transforms strings to ints.
+func (k *Key) parseInts(strs []string, addInvalid, returnOnInvalid bool) ([]int, error) {
+ vals := make([]int, 0, len(strs))
+ parser := func(str string) (interface{}, error) {
+ val, err := strconv.ParseInt(str, 0, 64)
+ return val, err
+ }
+ rawVals, err := k.doParse(strs, addInvalid, returnOnInvalid, parser)
+ if err == nil {
+ for _, val := range rawVals {
+ vals = append(vals, int(val.(int64)))
+ }
+ }
+ return vals, err
+}
+
+// parseInt64s transforms strings to int64s.
+func (k *Key) parseInt64s(strs []string, addInvalid, returnOnInvalid bool) ([]int64, error) {
+ vals := make([]int64, 0, len(strs))
+ parser := func(str string) (interface{}, error) {
+ val, err := strconv.ParseInt(str, 0, 64)
+ return val, err
+ }
+
+ rawVals, err := k.doParse(strs, addInvalid, returnOnInvalid, parser)
+ if err == nil {
+ for _, val := range rawVals {
+ vals = append(vals, val.(int64))
+ }
+ }
+ return vals, err
+}
+
+// parseUints transforms strings to uints.
+func (k *Key) parseUints(strs []string, addInvalid, returnOnInvalid bool) ([]uint, error) {
+ vals := make([]uint, 0, len(strs))
+ parser := func(str string) (interface{}, error) {
+ val, err := strconv.ParseUint(str, 0, 64)
+ return val, err
+ }
+
+ rawVals, err := k.doParse(strs, addInvalid, returnOnInvalid, parser)
+ if err == nil {
+ for _, val := range rawVals {
+ vals = append(vals, uint(val.(uint64)))
+ }
+ }
+ return vals, err
+}
+
+// parseUint64s transforms strings to uint64s.
+func (k *Key) parseUint64s(strs []string, addInvalid, returnOnInvalid bool) ([]uint64, error) {
+ vals := make([]uint64, 0, len(strs))
+ parser := func(str string) (interface{}, error) {
+ val, err := strconv.ParseUint(str, 0, 64)
+ return val, err
+ }
+ rawVals, err := k.doParse(strs, addInvalid, returnOnInvalid, parser)
+ if err == nil {
+ for _, val := range rawVals {
+ vals = append(vals, val.(uint64))
+ }
+ }
+ return vals, err
+}
+
+type Parser func(str string) (interface{}, error)
+
+// parseTimesFormat transforms strings to times in given format.
+func (k *Key) parseTimesFormat(format string, strs []string, addInvalid, returnOnInvalid bool) ([]time.Time, error) {
+ vals := make([]time.Time, 0, len(strs))
+ parser := func(str string) (interface{}, error) {
+ val, err := time.Parse(format, str)
+ return val, err
+ }
+ rawVals, err := k.doParse(strs, addInvalid, returnOnInvalid, parser)
+ if err == nil {
+ for _, val := range rawVals {
+ vals = append(vals, val.(time.Time))
+ }
+ }
+ return vals, err
+}
+
+// doParse transforms strings to different types
+func (k *Key) doParse(strs []string, addInvalid, returnOnInvalid bool, parser Parser) ([]interface{}, error) {
+ vals := make([]interface{}, 0, len(strs))
+ for _, str := range strs {
+ val, err := parser(str)
+ if err != nil && returnOnInvalid {
+ return nil, err
+ }
+ if err == nil || addInvalid {
+ vals = append(vals, val)
+ }
+ }
+ return vals, nil
+}
+
+// SetValue changes key value.
+func (k *Key) SetValue(v string) {
+ if k.s.f.BlockMode {
+ k.s.f.lock.Lock()
+ defer k.s.f.lock.Unlock()
+ }
+
+ k.value = v
+ k.s.keysHash[k.name] = v
+}
diff --git a/vendor/gopkg.in/ini.v1/parser.go b/vendor/gopkg.in/ini.v1/parser.go
@@ -0,0 +1,528 @@
+// Copyright 2015 Unknwon
+//
+// Licensed under the Apache License, Version 2.0 (the "License"): you may
+// not use this file except in compliance with the License. You may obtain
+// a copy of the License at
+//
+// http://www.apache.org/licenses/LICENSE-2.0
+//
+// Unless required by applicable law or agreed to in writing, software
+// distributed under the License is distributed on an "AS IS" BASIS, WITHOUT
+// WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the
+// License for the specific language governing permissions and limitations
+// under the License.
+
+package ini
+
+import (
+ "bufio"
+ "bytes"
+ "fmt"
+ "io"
+ "regexp"
+ "strconv"
+ "strings"
+ "unicode"
+)
+
+const minReaderBufferSize = 4096
+
+var pythonMultiline = regexp.MustCompile(`^([\t\f ]+)(.*)`)
+
+type parserOptions struct {
+ IgnoreContinuation bool
+ IgnoreInlineComment bool
+ AllowPythonMultilineValues bool
+ SpaceBeforeInlineComment bool
+ UnescapeValueDoubleQuotes bool
+ UnescapeValueCommentSymbols bool
+ PreserveSurroundedQuote bool
+ DebugFunc DebugFunc
+ ReaderBufferSize int
+}
+
+type parser struct {
+ buf *bufio.Reader
+ options parserOptions
+
+ isEOF bool
+ count int
+ comment *bytes.Buffer
+}
+
+func (p *parser) debug(format string, args ...interface{}) {
+ if p.options.DebugFunc != nil {
+ p.options.DebugFunc(fmt.Sprintf(format, args...))
+ }
+}
+
+func newParser(r io.Reader, opts parserOptions) *parser {
+ size := opts.ReaderBufferSize
+ if size < minReaderBufferSize {
+ size = minReaderBufferSize
+ }
+
+ return &parser{
+ buf: bufio.NewReaderSize(r, size),
+ options: opts,
+ count: 1,
+ comment: &bytes.Buffer{},
+ }
+}
+
+// BOM handles header of UTF-8, UTF-16 LE and UTF-16 BE's BOM format.
+// http://en.wikipedia.org/wiki/Byte_order_mark#Representations_of_byte_order_marks_by_encoding
+func (p *parser) BOM() error {
+ mask, err := p.buf.Peek(2)
+ if err != nil && err != io.EOF {
+ return err
+ } else if len(mask) < 2 {
+ return nil
+ }
+
+ switch {
+ case mask[0] == 254 && mask[1] == 255:
+ fallthrough
+ case mask[0] == 255 && mask[1] == 254:
+ _, err = p.buf.Read(mask)
+ if err != nil {
+ return err
+ }
+ case mask[0] == 239 && mask[1] == 187:
+ mask, err := p.buf.Peek(3)
+ if err != nil && err != io.EOF {
+ return err
+ } else if len(mask) < 3 {
+ return nil
+ }
+ if mask[2] == 191 {
+ _, err = p.buf.Read(mask)
+ if err != nil {
+ return err
+ }
+ }
+ }
+ return nil
+}
+
+func (p *parser) readUntil(delim byte) ([]byte, error) {
+ data, err := p.buf.ReadBytes(delim)
+ if err != nil {
+ if err == io.EOF {
+ p.isEOF = true
+ } else {
+ return nil, err
+ }
+ }
+ return data, nil
+}
+
+func cleanComment(in []byte) ([]byte, bool) {
+ i := bytes.IndexAny(in, "#;")
+ if i == -1 {
+ return nil, false
+ }
+ return in[i:], true
+}
+
+func readKeyName(delimiters string, in []byte) (string, int, error) {
+ line := string(in)
+
+ // Check if key name surrounded by quotes.
+ var keyQuote string
+ switch line[0] {
+ case '"':
+ if len(line) > 6 && line[0:3] == `"""` {
+ keyQuote = `"""`
+ } else {
+ keyQuote = `"`
+ }
+ case '`':
+ keyQuote = "`"
+ }
+
+ // Get out key name
+ var endIdx int
+ if len(keyQuote) > 0 {
+ startIdx := len(keyQuote)
+ // FIXME: fail case -> """"""name"""=value
+ pos := strings.Index(line[startIdx:], keyQuote)
+ if pos == -1 {
+ return "", -1, fmt.Errorf("missing closing key quote: %s", line)
+ }
+ pos += startIdx
+
+ // Find key-value delimiter
+ i := strings.IndexAny(line[pos+startIdx:], delimiters)
+ if i < 0 {
+ return "", -1, ErrDelimiterNotFound{line}
+ }
+ endIdx = pos + i
+ return strings.TrimSpace(line[startIdx:pos]), endIdx + startIdx + 1, nil
+ }
+
+ endIdx = strings.IndexAny(line, delimiters)
+ if endIdx < 0 {
+ return "", -1, ErrDelimiterNotFound{line}
+ }
+ if endIdx == 0 {
+ return "", -1, ErrEmptyKeyName{line}
+ }
+
+ return strings.TrimSpace(line[0:endIdx]), endIdx + 1, nil
+}
+
+func (p *parser) readMultilines(line, val, valQuote string) (string, error) {
+ for {
+ data, err := p.readUntil('\n')
+ if err != nil {
+ return "", err
+ }
+ next := string(data)
+
+ pos := strings.LastIndex(next, valQuote)
+ if pos > -1 {
+ // Check if the line ends with backslash continuation after the quote
+ restOfLine := strings.TrimRight(next[pos+len(valQuote):], "\r\n")
+ if !p.options.IgnoreContinuation && strings.HasSuffix(strings.TrimSpace(restOfLine), `\`) {
+ val += next
+ continue
+ }
+
+ val += next[:pos]
+
+ comment, has := cleanComment([]byte(next[pos:]))
+ if has {
+ p.comment.Write(bytes.TrimSpace(comment))
+ }
+ break
+ }
+ val += next
+ if p.isEOF {
+ return "", fmt.Errorf("missing closing key quote from %q to %q", line, next)
+ }
+ }
+ return val, nil
+}
+
+func (p *parser) readContinuationLines(val string) (string, error) {
+ for {
+ data, err := p.readUntil('\n')
+ if err != nil {
+ return "", err
+ }
+ next := strings.TrimSpace(string(data))
+
+ if len(next) == 0 {
+ break
+ }
+ val += next
+ if val[len(val)-1] != '\\' {
+ break
+ }
+ val = val[:len(val)-1]
+ }
+ return val, nil
+}
+
+// hasSurroundedQuote check if and only if the first and last characters
+// are quotes \" or \'.
+// It returns false if any other parts also contain same kind of quotes.
+func hasSurroundedQuote(in string, quote byte) bool {
+ return len(in) >= 2 && in[0] == quote && in[len(in)-1] == quote &&
+ strings.IndexByte(in[1:], quote) == len(in)-2
+}
+
+func (p *parser) readValue(in []byte, bufferSize int) (string, error) {
+
+ line := strings.TrimLeftFunc(string(in), unicode.IsSpace)
+ if len(line) == 0 {
+ if p.options.AllowPythonMultilineValues && len(in) > 0 && in[len(in)-1] == '\n' {
+ return p.readPythonMultilines(line, bufferSize)
+ }
+ return "", nil
+ }
+
+ var valQuote string
+ if len(line) > 3 && line[0:3] == `"""` {
+ valQuote = `"""`
+ } else if line[0] == '`' {
+ valQuote = "`"
+ } else if p.options.UnescapeValueDoubleQuotes && line[0] == '"' {
+ valQuote = `"`
+ }
+
+ if len(valQuote) > 0 {
+ startIdx := len(valQuote)
+ pos := strings.LastIndex(line[startIdx:], valQuote)
+ // Check for multi-line value
+ if pos == -1 {
+ return p.readMultilines(line, line[startIdx:], valQuote)
+ }
+
+ if p.options.UnescapeValueDoubleQuotes && valQuote == `"` {
+ return strings.ReplaceAll(line[startIdx:pos+startIdx], `\"`, `"`), nil
+ }
+ return line[startIdx : pos+startIdx], nil
+ }
+
+ lastChar := line[len(line)-1]
+ // Won't be able to reach here if value only contains whitespace
+ line = strings.TrimSpace(line)
+ trimmedLastChar := line[len(line)-1]
+
+ // Check continuation lines when desired
+ if !p.options.IgnoreContinuation && trimmedLastChar == '\\' {
+ return p.readContinuationLines(line[:len(line)-1])
+ }
+
+ // Check if ignore inline comment
+ if !p.options.IgnoreInlineComment {
+ var i int
+ if p.options.SpaceBeforeInlineComment {
+ i = strings.Index(line, " #")
+ if i == -1 {
+ i = strings.Index(line, " ;")
+ }
+
+ } else {
+ i = strings.IndexAny(line, "#;")
+ }
+
+ if i > -1 {
+ p.comment.WriteString(line[i:])
+ line = strings.TrimSpace(line[:i])
+ }
+
+ }
+
+ // Trim single and double quotes
+ if (hasSurroundedQuote(line, '\'') ||
+ hasSurroundedQuote(line, '"')) && !p.options.PreserveSurroundedQuote {
+ line = line[1 : len(line)-1]
+ } else if len(valQuote) == 0 && p.options.UnescapeValueCommentSymbols {
+ line = strings.ReplaceAll(line, `\;`, ";")
+ line = strings.ReplaceAll(line, `\#`, "#")
+ } else if p.options.AllowPythonMultilineValues && lastChar == '\n' {
+ return p.readPythonMultilines(line, bufferSize)
+ }
+
+ return line, nil
+}
+
+func (p *parser) readPythonMultilines(line string, bufferSize int) (string, error) {
+ parserBufferPeekResult, _ := p.buf.Peek(bufferSize)
+ peekBuffer := bytes.NewBuffer(parserBufferPeekResult)
+
+ for {
+ peekData, peekErr := peekBuffer.ReadBytes('\n')
+ if peekErr != nil && peekErr != io.EOF {
+ p.debug("readPythonMultilines: failed to peek with error: %v", peekErr)
+ return "", peekErr
+ }
+
+ p.debug("readPythonMultilines: parsing %q", string(peekData))
+
+ peekMatches := pythonMultiline.FindStringSubmatch(string(peekData))
+ p.debug("readPythonMultilines: matched %d parts", len(peekMatches))
+ for n, v := range peekMatches {
+ p.debug(" %d: %q", n, v)
+ }
+
+ // Return if not a Python multiline value.
+ if len(peekMatches) != 3 {
+ p.debug("readPythonMultilines: end of value, got: %q", line)
+ return line, nil
+ }
+
+ // Advance the parser reader (buffer) in-sync with the peek buffer.
+ _, err := p.buf.Discard(len(peekData))
+ if err != nil {
+ p.debug("readPythonMultilines: failed to skip to the end, returning error")
+ return "", err
+ }
+
+ line += "\n" + peekMatches[0]
+ }
+}
+
+// parse parses data through an io.Reader.
+func (f *File) parse(reader io.Reader) (err error) {
+ p := newParser(reader, parserOptions{
+ IgnoreContinuation: f.options.IgnoreContinuation,
+ IgnoreInlineComment: f.options.IgnoreInlineComment,
+ AllowPythonMultilineValues: f.options.AllowPythonMultilineValues,
+ SpaceBeforeInlineComment: f.options.SpaceBeforeInlineComment,
+ UnescapeValueDoubleQuotes: f.options.UnescapeValueDoubleQuotes,
+ UnescapeValueCommentSymbols: f.options.UnescapeValueCommentSymbols,
+ PreserveSurroundedQuote: f.options.PreserveSurroundedQuote,
+ DebugFunc: f.options.DebugFunc,
+ ReaderBufferSize: f.options.ReaderBufferSize,
+ })
+ if err = p.BOM(); err != nil {
+ return fmt.Errorf("BOM: %v", err)
+ }
+
+ // Ignore error because default section name is never empty string.
+ name := DefaultSection
+ if f.options.Insensitive || f.options.InsensitiveSections {
+ name = strings.ToLower(DefaultSection)
+ }
+ section, _ := f.NewSection(name)
+
+ // This "last" is not strictly equivalent to "previous one" if current key is not the first nested key
+ var isLastValueEmpty bool
+ var lastRegularKey *Key
+
+ var line []byte
+ var inUnparseableSection bool
+
+ // NOTE: Iterate and increase `currentPeekSize` until
+ // the size of the parser buffer is found.
+ // TODO(unknwon): When Golang 1.10 is the lowest version supported, replace with `parserBufferSize := p.buf.Size()`.
+ parserBufferSize := 0
+ // NOTE: Peek 4kb at a time.
+ currentPeekSize := minReaderBufferSize
+
+ if f.options.AllowPythonMultilineValues {
+ for {
+ peekBytes, _ := p.buf.Peek(currentPeekSize)
+ peekBytesLength := len(peekBytes)
+
+ if parserBufferSize >= peekBytesLength {
+ break
+ }
+
+ currentPeekSize *= 2
+ parserBufferSize = peekBytesLength
+ }
+ }
+
+ for !p.isEOF {
+ line, err = p.readUntil('\n')
+ if err != nil {
+ return err
+ }
+
+ if f.options.AllowNestedValues &&
+ isLastValueEmpty && len(line) > 0 {
+ if line[0] == ' ' || line[0] == '\t' {
+ err = lastRegularKey.addNestedValue(string(bytes.TrimSpace(line)))
+ if err != nil {
+ return err
+ }
+ continue
+ }
+ }
+
+ line = bytes.TrimLeftFunc(line, unicode.IsSpace)
+ if len(line) == 0 {
+ continue
+ }
+
+ // Comments
+ if line[0] == '#' || line[0] == ';' {
+ // Note: we do not care ending line break,
+ // it is needed for adding second line,
+ // so just clean it once at the end when set to value.
+ p.comment.Write(line)
+ continue
+ }
+
+ // Section
+ if line[0] == '[' {
+ // Read to the next ']' (TODO: support quoted strings)
+ closeIdx := bytes.LastIndexByte(line, ']')
+ if closeIdx == -1 {
+ return fmt.Errorf("unclosed section: %s", line)
+ }
+
+ name := string(line[1:closeIdx])
+ section, err = f.NewSection(name)
+ if err != nil {
+ return err
+ }
+
+ comment, has := cleanComment(line[closeIdx+1:])
+ if has {
+ p.comment.Write(comment)
+ }
+
+ section.Comment = strings.TrimSpace(p.comment.String())
+
+ // Reset auto-counter and comments
+ p.comment.Reset()
+ p.count = 1
+ // Nested values can't span sections
+ isLastValueEmpty = false
+
+ inUnparseableSection = false
+ for i := range f.options.UnparseableSections {
+ if f.options.UnparseableSections[i] == name ||
+ ((f.options.Insensitive || f.options.InsensitiveSections) && strings.EqualFold(f.options.UnparseableSections[i], name)) {
+ inUnparseableSection = true
+ continue
+ }
+ }
+ continue
+ }
+
+ if inUnparseableSection {
+ section.isRawSection = true
+ section.rawBody += string(line)
+ continue
+ }
+
+ kname, offset, err := readKeyName(f.options.KeyValueDelimiters, line)
+ if err != nil {
+ switch {
+ // Treat as boolean key when desired, and whole line is key name.
+ case IsErrDelimiterNotFound(err):
+ switch {
+ case f.options.AllowBooleanKeys:
+ kname, err := p.readValue(line, parserBufferSize)
+ if err != nil {
+ return err
+ }
+ key, err := section.NewBooleanKey(kname)
+ if err != nil {
+ return err
+ }
+ key.Comment = strings.TrimSpace(p.comment.String())
+ p.comment.Reset()
+ continue
+
+ case f.options.SkipUnrecognizableLines:
+ continue
+ }
+ case IsErrEmptyKeyName(err) && f.options.SkipUnrecognizableLines:
+ continue
+ }
+ return err
+ }
+
+ // Auto increment.
+ isAutoIncr := false
+ if kname == "-" {
+ isAutoIncr = true
+ kname = "#" + strconv.Itoa(p.count)
+ p.count++
+ }
+
+ value, err := p.readValue(line[offset:], parserBufferSize)
+ if err != nil {
+ return err
+ }
+ isLastValueEmpty = len(value) == 0
+
+ key, err := section.NewKey(kname, value)
+ if err != nil {
+ return err
+ }
+ key.isAutoIncrement = isAutoIncr
+ key.Comment = strings.TrimSpace(p.comment.String())
+ p.comment.Reset()
+ lastRegularKey = key
+ }
+ return nil
+}
diff --git a/vendor/gopkg.in/ini.v1/section.go b/vendor/gopkg.in/ini.v1/section.go
@@ -0,0 +1,256 @@
+// Copyright 2014 Unknwon
+//
+// Licensed under the Apache License, Version 2.0 (the "License"): you may
+// not use this file except in compliance with the License. You may obtain
+// a copy of the License at
+//
+// http://www.apache.org/licenses/LICENSE-2.0
+//
+// Unless required by applicable law or agreed to in writing, software
+// distributed under the License is distributed on an "AS IS" BASIS, WITHOUT
+// WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the
+// License for the specific language governing permissions and limitations
+// under the License.
+
+package ini
+
+import (
+ "errors"
+ "fmt"
+ "strings"
+)
+
+// Section represents a config section.
+type Section struct {
+ f *File
+ Comment string
+ name string
+ keys map[string]*Key
+ keyList []string
+ keysHash map[string]string
+
+ isRawSection bool
+ rawBody string
+}
+
+func newSection(f *File, name string) *Section {
+ return &Section{
+ f: f,
+ name: name,
+ keys: make(map[string]*Key),
+ keyList: make([]string, 0, 10),
+ keysHash: make(map[string]string),
+ }
+}
+
+// Name returns name of Section.
+func (s *Section) Name() string {
+ return s.name
+}
+
+// Body returns rawBody of Section if the section was marked as unparseable.
+// It still follows the other rules of the INI format surrounding leading/trailing whitespace.
+func (s *Section) Body() string {
+ return strings.TrimSpace(s.rawBody)
+}
+
+// SetBody updates body content only if section is raw.
+func (s *Section) SetBody(body string) {
+ if !s.isRawSection {
+ return
+ }
+ s.rawBody = body
+}
+
+// NewKey creates a new key to given section.
+func (s *Section) NewKey(name, val string) (*Key, error) {
+ if len(name) == 0 {
+ return nil, errors.New("error creating new key: empty key name")
+ } else if s.f.options.Insensitive || s.f.options.InsensitiveKeys {
+ name = strings.ToLower(name)
+ }
+
+ if s.f.BlockMode {
+ s.f.lock.Lock()
+ defer s.f.lock.Unlock()
+ }
+
+ if inSlice(name, s.keyList) {
+ if s.f.options.AllowShadows {
+ if err := s.keys[name].addShadow(val); err != nil {
+ return nil, err
+ }
+ } else {
+ s.keys[name].value = val
+ s.keysHash[name] = val
+ }
+ return s.keys[name], nil
+ }
+
+ s.keyList = append(s.keyList, name)
+ s.keys[name] = newKey(s, name, val)
+ s.keysHash[name] = val
+ return s.keys[name], nil
+}
+
+// NewBooleanKey creates a new boolean type key to given section.
+func (s *Section) NewBooleanKey(name string) (*Key, error) {
+ key, err := s.NewKey(name, "true")
+ if err != nil {
+ return nil, err
+ }
+
+ key.isBooleanType = true
+ return key, nil
+}
+
+// GetKey returns key in section by given name.
+func (s *Section) GetKey(name string) (*Key, error) {
+ if s.f.BlockMode {
+ s.f.lock.RLock()
+ }
+ if s.f.options.Insensitive || s.f.options.InsensitiveKeys {
+ name = strings.ToLower(name)
+ }
+ key := s.keys[name]
+ if s.f.BlockMode {
+ s.f.lock.RUnlock()
+ }
+
+ if key == nil {
+ // Check if it is a child-section.
+ sname := s.name
+ for {
+ if i := strings.LastIndex(sname, s.f.options.ChildSectionDelimiter); i > -1 {
+ sname = sname[:i]
+ sec, err := s.f.GetSection(sname)
+ if err != nil {
+ continue
+ }
+ return sec.GetKey(name)
+ }
+ break
+ }
+ return nil, fmt.Errorf("error when getting key of section %q: key %q not exists", s.name, name)
+ }
+ return key, nil
+}
+
+// HasKey returns true if section contains a key with given name.
+func (s *Section) HasKey(name string) bool {
+ key, _ := s.GetKey(name)
+ return key != nil
+}
+
+// Deprecated: Use "HasKey" instead.
+func (s *Section) Haskey(name string) bool {
+ return s.HasKey(name)
+}
+
+// HasValue returns true if section contains given raw value.
+func (s *Section) HasValue(value string) bool {
+ if s.f.BlockMode {
+ s.f.lock.RLock()
+ defer s.f.lock.RUnlock()
+ }
+
+ for _, k := range s.keys {
+ if value == k.value {
+ return true
+ }
+ }
+ return false
+}
+
+// Key assumes named Key exists in section and returns a zero-value when not.
+func (s *Section) Key(name string) *Key {
+ key, err := s.GetKey(name)
+ if err != nil {
+ // It's OK here because the only possible error is empty key name,
+ // but if it's empty, this piece of code won't be executed.
+ key, _ = s.NewKey(name, "")
+ return key
+ }
+ return key
+}
+
+// Keys returns list of keys of section.
+func (s *Section) Keys() []*Key {
+ keys := make([]*Key, len(s.keyList))
+ for i := range s.keyList {
+ keys[i] = s.Key(s.keyList[i])
+ }
+ return keys
+}
+
+// ParentKeys returns list of keys of parent section.
+func (s *Section) ParentKeys() []*Key {
+ var parentKeys []*Key
+ sname := s.name
+ for {
+ if i := strings.LastIndex(sname, s.f.options.ChildSectionDelimiter); i > -1 {
+ sname = sname[:i]
+ sec, err := s.f.GetSection(sname)
+ if err != nil {
+ continue
+ }
+ parentKeys = append(parentKeys, sec.Keys()...)
+ } else {
+ break
+ }
+
+ }
+ return parentKeys
+}
+
+// KeyStrings returns list of key names of section.
+func (s *Section) KeyStrings() []string {
+ list := make([]string, len(s.keyList))
+ copy(list, s.keyList)
+ return list
+}
+
+// KeysHash returns keys hash consisting of names and values.
+func (s *Section) KeysHash() map[string]string {
+ if s.f.BlockMode {
+ s.f.lock.RLock()
+ defer s.f.lock.RUnlock()
+ }
+
+ hash := make(map[string]string, len(s.keysHash))
+ for key, value := range s.keysHash {
+ hash[key] = value
+ }
+ return hash
+}
+
+// DeleteKey deletes a key from section.
+func (s *Section) DeleteKey(name string) {
+ if s.f.BlockMode {
+ s.f.lock.Lock()
+ defer s.f.lock.Unlock()
+ }
+
+ for i, k := range s.keyList {
+ if k == name {
+ s.keyList = append(s.keyList[:i], s.keyList[i+1:]...)
+ delete(s.keys, name)
+ delete(s.keysHash, name)
+ return
+ }
+ }
+}
+
+// ChildSections returns a list of child sections of current section.
+// For example, "[parent.child1]" and "[parent.child12]" are child sections
+// of section "[parent]".
+func (s *Section) ChildSections() []*Section {
+ prefix := s.name + s.f.options.ChildSectionDelimiter
+ children := make([]*Section, 0, 3)
+ for _, name := range s.f.sectionList {
+ if strings.HasPrefix(name, prefix) {
+ children = append(children, s.f.sections[name]...)
+ }
+ }
+ return children
+}
diff --git a/vendor/gopkg.in/ini.v1/struct.go b/vendor/gopkg.in/ini.v1/struct.go
@@ -0,0 +1,747 @@
+// Copyright 2014 Unknwon
+//
+// Licensed under the Apache License, Version 2.0 (the "License"): you may
+// not use this file except in compliance with the License. You may obtain
+// a copy of the License at
+//
+// http://www.apache.org/licenses/LICENSE-2.0
+//
+// Unless required by applicable law or agreed to in writing, software
+// distributed under the License is distributed on an "AS IS" BASIS, WITHOUT
+// WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the
+// License for the specific language governing permissions and limitations
+// under the License.
+
+package ini
+
+import (
+ "bytes"
+ "errors"
+ "fmt"
+ "reflect"
+ "strings"
+ "time"
+ "unicode"
+)
+
+// NameMapper represents a ini tag name mapper.
+type NameMapper func(string) string
+
+// Built-in name getters.
+var (
+ // SnackCase converts to format SNACK_CASE.
+ SnackCase NameMapper = func(raw string) string {
+ newstr := make([]rune, 0, len(raw))
+ for i, chr := range raw {
+ if isUpper := 'A' <= chr && chr <= 'Z'; isUpper {
+ if i > 0 {
+ newstr = append(newstr, '_')
+ }
+ }
+ newstr = append(newstr, unicode.ToUpper(chr))
+ }
+ return string(newstr)
+ }
+ // TitleUnderscore converts to format title_underscore.
+ TitleUnderscore NameMapper = func(raw string) string {
+ newstr := make([]rune, 0, len(raw))
+ for i, chr := range raw {
+ if isUpper := 'A' <= chr && chr <= 'Z'; isUpper {
+ if i > 0 {
+ newstr = append(newstr, '_')
+ }
+ chr -= 'A' - 'a'
+ }
+ newstr = append(newstr, chr)
+ }
+ return string(newstr)
+ }
+)
+
+func (s *Section) parseFieldName(raw, actual string) string {
+ if len(actual) > 0 {
+ return actual
+ }
+ if s.f.NameMapper != nil {
+ return s.f.NameMapper(raw)
+ }
+ return raw
+}
+
+func parseDelim(actual string) string {
+ if len(actual) > 0 {
+ return actual
+ }
+ return ","
+}
+
+var reflectTime = reflect.TypeOf(time.Now()).Kind()
+
+// setSliceWithProperType sets proper values to slice based on its type.
+func setSliceWithProperType(key *Key, field reflect.Value, delim string, allowShadow, isStrict bool) error {
+ var strs []string
+ if allowShadow {
+ strs = key.StringsWithShadows(delim)
+ } else {
+ strs = key.Strings(delim)
+ }
+
+ numVals := len(strs)
+ if numVals == 0 {
+ return nil
+ }
+
+ var vals interface{}
+ var err error
+
+ sliceOf := field.Type().Elem().Kind()
+ switch sliceOf {
+ case reflect.String:
+ vals = strs
+ case reflect.Int:
+ vals, err = key.parseInts(strs, true, false)
+ case reflect.Int64:
+ vals, err = key.parseInt64s(strs, true, false)
+ case reflect.Uint:
+ vals, err = key.parseUints(strs, true, false)
+ case reflect.Uint64:
+ vals, err = key.parseUint64s(strs, true, false)
+ case reflect.Float64:
+ vals, err = key.parseFloat64s(strs, true, false)
+ case reflect.Bool:
+ vals, err = key.parseBools(strs, true, false)
+ case reflectTime:
+ vals, err = key.parseTimesFormat(time.RFC3339, strs, true, false)
+ default:
+ return fmt.Errorf("unsupported type '[]%s'", sliceOf)
+ }
+ if err != nil && isStrict {
+ return err
+ }
+
+ slice := reflect.MakeSlice(field.Type(), numVals, numVals)
+ for i := 0; i < numVals; i++ {
+ switch sliceOf {
+ case reflect.String:
+ slice.Index(i).Set(reflect.ValueOf(vals.([]string)[i]))
+ case reflect.Int:
+ slice.Index(i).Set(reflect.ValueOf(vals.([]int)[i]))
+ case reflect.Int64:
+ slice.Index(i).Set(reflect.ValueOf(vals.([]int64)[i]))
+ case reflect.Uint:
+ slice.Index(i).Set(reflect.ValueOf(vals.([]uint)[i]))
+ case reflect.Uint64:
+ slice.Index(i).Set(reflect.ValueOf(vals.([]uint64)[i]))
+ case reflect.Float64:
+ slice.Index(i).Set(reflect.ValueOf(vals.([]float64)[i]))
+ case reflect.Bool:
+ slice.Index(i).Set(reflect.ValueOf(vals.([]bool)[i]))
+ case reflectTime:
+ slice.Index(i).Set(reflect.ValueOf(vals.([]time.Time)[i]))
+ }
+ }
+ field.Set(slice)
+ return nil
+}
+
+func wrapStrictError(err error, isStrict bool) error {
+ if isStrict {
+ return err
+ }
+ return nil
+}
+
+// setWithProperType sets proper value to field based on its type,
+// but it does not return error for failing parsing,
+// because we want to use default value that is already assigned to struct.
+func setWithProperType(t reflect.Type, key *Key, field reflect.Value, delim string, allowShadow, isStrict bool) error {
+ vt := t
+ isPtr := t.Kind() == reflect.Ptr
+ if isPtr {
+ vt = t.Elem()
+ }
+ switch vt.Kind() {
+ case reflect.String:
+ stringVal := key.String()
+ if isPtr {
+ field.Set(reflect.ValueOf(&stringVal))
+ } else if len(stringVal) > 0 {
+ field.SetString(key.String())
+ }
+ case reflect.Bool:
+ boolVal, err := key.Bool()
+ if err != nil {
+ return wrapStrictError(err, isStrict)
+ }
+ if isPtr {
+ field.Set(reflect.ValueOf(&boolVal))
+ } else {
+ field.SetBool(boolVal)
+ }
+ case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64:
+ // ParseDuration will not return err for `0`, so check the type name
+ if vt.Name() == "Duration" {
+ durationVal, err := key.Duration()
+ if err != nil {
+ if intVal, err := key.Int64(); err == nil {
+ field.SetInt(intVal)
+ return nil
+ }
+ return wrapStrictError(err, isStrict)
+ }
+ if isPtr {
+ field.Set(reflect.ValueOf(&durationVal))
+ } else if int64(durationVal) > 0 {
+ field.Set(reflect.ValueOf(durationVal))
+ }
+ return nil
+ }
+
+ intVal, err := key.Int64()
+ if err != nil {
+ return wrapStrictError(err, isStrict)
+ }
+ if isPtr {
+ pv := reflect.New(t.Elem())
+ pv.Elem().SetInt(intVal)
+ field.Set(pv)
+ } else {
+ field.SetInt(intVal)
+ }
+ // byte is an alias for uint8, so supporting uint8 breaks support for byte
+ case reflect.Uint, reflect.Uint16, reflect.Uint32, reflect.Uint64:
+ durationVal, err := key.Duration()
+ // Skip zero value
+ if err == nil && uint64(durationVal) > 0 {
+ if isPtr {
+ field.Set(reflect.ValueOf(&durationVal))
+ } else {
+ field.Set(reflect.ValueOf(durationVal))
+ }
+ return nil
+ }
+
+ uintVal, err := key.Uint64()
+ if err != nil {
+ return wrapStrictError(err, isStrict)
+ }
+ if isPtr {
+ pv := reflect.New(t.Elem())
+ pv.Elem().SetUint(uintVal)
+ field.Set(pv)
+ } else {
+ field.SetUint(uintVal)
+ }
+
+ case reflect.Float32, reflect.Float64:
+ floatVal, err := key.Float64()
+ if err != nil {
+ return wrapStrictError(err, isStrict)
+ }
+ if isPtr {
+ pv := reflect.New(t.Elem())
+ pv.Elem().SetFloat(floatVal)
+ field.Set(pv)
+ } else {
+ field.SetFloat(floatVal)
+ }
+ case reflectTime:
+ timeVal, err := key.Time()
+ if err != nil {
+ return wrapStrictError(err, isStrict)
+ }
+ if isPtr {
+ field.Set(reflect.ValueOf(&timeVal))
+ } else {
+ field.Set(reflect.ValueOf(timeVal))
+ }
+ case reflect.Slice:
+ return setSliceWithProperType(key, field, delim, allowShadow, isStrict)
+ default:
+ return fmt.Errorf("unsupported type %q", t)
+ }
+ return nil
+}
+
+func parseTagOptions(tag string) (rawName string, omitEmpty bool, allowShadow bool, allowNonUnique bool, extends bool) {
+ opts := strings.SplitN(tag, ",", 5)
+ rawName = opts[0]
+ for _, opt := range opts[1:] {
+ omitEmpty = omitEmpty || (opt == "omitempty")
+ allowShadow = allowShadow || (opt == "allowshadow")
+ allowNonUnique = allowNonUnique || (opt == "nonunique")
+ extends = extends || (opt == "extends")
+ }
+ return rawName, omitEmpty, allowShadow, allowNonUnique, extends
+}
+
+// mapToField maps the given value to the matching field of the given section.
+// The sectionIndex is the index (if non unique sections are enabled) to which the value should be added.
+func (s *Section) mapToField(val reflect.Value, isStrict bool, sectionIndex int, sectionName string) error {
+ if val.Kind() == reflect.Ptr {
+ val = val.Elem()
+ }
+ typ := val.Type()
+
+ for i := 0; i < typ.NumField(); i++ {
+ field := val.Field(i)
+ tpField := typ.Field(i)
+
+ tag := tpField.Tag.Get("ini")
+ if tag == "-" {
+ continue
+ }
+
+ rawName, _, allowShadow, allowNonUnique, extends := parseTagOptions(tag)
+ fieldName := s.parseFieldName(tpField.Name, rawName)
+ if len(fieldName) == 0 || !field.CanSet() {
+ continue
+ }
+
+ isStruct := tpField.Type.Kind() == reflect.Struct
+ isStructPtr := tpField.Type.Kind() == reflect.Ptr && tpField.Type.Elem().Kind() == reflect.Struct
+ isAnonymousPtr := tpField.Type.Kind() == reflect.Ptr && tpField.Anonymous
+ if isAnonymousPtr {
+ field.Set(reflect.New(tpField.Type.Elem()))
+ }
+
+ if extends && (isAnonymousPtr || (isStruct && tpField.Anonymous)) {
+ if isStructPtr && field.IsNil() {
+ field.Set(reflect.New(tpField.Type.Elem()))
+ }
+ fieldSection := s
+ if rawName != "" {
+ sectionName = s.name + s.f.options.ChildSectionDelimiter + rawName
+ if secs, err := s.f.SectionsByName(sectionName); err == nil && sectionIndex < len(secs) {
+ fieldSection = secs[sectionIndex]
+ }
+ }
+ if err := fieldSection.mapToField(field, isStrict, sectionIndex, sectionName); err != nil {
+ return fmt.Errorf("map to field %q: %v", fieldName, err)
+ }
+ } else if isAnonymousPtr || isStruct || isStructPtr {
+ if secs, err := s.f.SectionsByName(fieldName); err == nil {
+ if len(secs) <= sectionIndex {
+ return fmt.Errorf("there are not enough sections (%d <= %d) for the field %q", len(secs), sectionIndex, fieldName)
+ }
+ // Only set the field to non-nil struct value if we have a section for it.
+ // Otherwise, we end up with a non-nil struct ptr even though there is no data.
+ if isStructPtr && field.IsNil() {
+ field.Set(reflect.New(tpField.Type.Elem()))
+ }
+ if err = secs[sectionIndex].mapToField(field, isStrict, sectionIndex, fieldName); err != nil {
+ return fmt.Errorf("map to field %q: %v", fieldName, err)
+ }
+ continue
+ }
+ }
+
+ // Map non-unique sections
+ if allowNonUnique && tpField.Type.Kind() == reflect.Slice {
+ newField, err := s.mapToSlice(fieldName, field, isStrict)
+ if err != nil {
+ return fmt.Errorf("map to slice %q: %v", fieldName, err)
+ }
+
+ field.Set(newField)
+ continue
+ }
+
+ if key, err := s.GetKey(fieldName); err == nil {
+ delim := parseDelim(tpField.Tag.Get("delim"))
+ if err = setWithProperType(tpField.Type, key, field, delim, allowShadow, isStrict); err != nil {
+ return fmt.Errorf("set field %q: %v", fieldName, err)
+ }
+ }
+ }
+ return nil
+}
+
+// mapToSlice maps all sections with the same name and returns the new value.
+// The type of the Value must be a slice.
+func (s *Section) mapToSlice(secName string, val reflect.Value, isStrict bool) (reflect.Value, error) {
+ secs, err := s.f.SectionsByName(secName)
+ if err != nil {
+ return reflect.Value{}, err
+ }
+
+ typ := val.Type().Elem()
+ for i, sec := range secs {
+ elem := reflect.New(typ)
+ if err = sec.mapToField(elem, isStrict, i, sec.name); err != nil {
+ return reflect.Value{}, fmt.Errorf("map to field from section %q: %v", secName, err)
+ }
+
+ val = reflect.Append(val, elem.Elem())
+ }
+ return val, nil
+}
+
+// mapTo maps a section to object v.
+func (s *Section) mapTo(v interface{}, isStrict bool) error {
+ typ := reflect.TypeOf(v)
+ val := reflect.ValueOf(v)
+ if typ.Kind() == reflect.Ptr {
+ typ = typ.Elem()
+ val = val.Elem()
+ } else {
+ return errors.New("not a pointer to a struct")
+ }
+
+ if typ.Kind() == reflect.Slice {
+ newField, err := s.mapToSlice(s.name, val, isStrict)
+ if err != nil {
+ return err
+ }
+
+ val.Set(newField)
+ return nil
+ }
+
+ return s.mapToField(val, isStrict, 0, s.name)
+}
+
+// MapTo maps section to given struct.
+func (s *Section) MapTo(v interface{}) error {
+ return s.mapTo(v, false)
+}
+
+// StrictMapTo maps section to given struct in strict mode,
+// which returns all possible error including value parsing error.
+func (s *Section) StrictMapTo(v interface{}) error {
+ return s.mapTo(v, true)
+}
+
+// MapTo maps file to given struct.
+func (f *File) MapTo(v interface{}) error {
+ return f.Section("").MapTo(v)
+}
+
+// StrictMapTo maps file to given struct in strict mode,
+// which returns all possible error including value parsing error.
+func (f *File) StrictMapTo(v interface{}) error {
+ return f.Section("").StrictMapTo(v)
+}
+
+// MapToWithMapper maps data sources to given struct with name mapper.
+func MapToWithMapper(v interface{}, mapper NameMapper, source interface{}, others ...interface{}) error {
+ cfg, err := Load(source, others...)
+ if err != nil {
+ return err
+ }
+ cfg.NameMapper = mapper
+ return cfg.MapTo(v)
+}
+
+// StrictMapToWithMapper maps data sources to given struct with name mapper in strict mode,
+// which returns all possible error including value parsing error.
+func StrictMapToWithMapper(v interface{}, mapper NameMapper, source interface{}, others ...interface{}) error {
+ cfg, err := Load(source, others...)
+ if err != nil {
+ return err
+ }
+ cfg.NameMapper = mapper
+ return cfg.StrictMapTo(v)
+}
+
+// MapTo maps data sources to given struct.
+func MapTo(v, source interface{}, others ...interface{}) error {
+ return MapToWithMapper(v, nil, source, others...)
+}
+
+// StrictMapTo maps data sources to given struct in strict mode,
+// which returns all possible error including value parsing error.
+func StrictMapTo(v, source interface{}, others ...interface{}) error {
+ return StrictMapToWithMapper(v, nil, source, others...)
+}
+
+// reflectSliceWithProperType does the opposite thing as setSliceWithProperType.
+func reflectSliceWithProperType(key *Key, field reflect.Value, delim string, allowShadow bool) error {
+ slice := field.Slice(0, field.Len())
+ if field.Len() == 0 {
+ return nil
+ }
+ sliceOf := field.Type().Elem().Kind()
+
+ if allowShadow {
+ var keyWithShadows *Key
+ for i := 0; i < field.Len(); i++ {
+ var val string
+ switch sliceOf {
+ case reflect.String:
+ val = slice.Index(i).String()
+ case reflect.Int, reflect.Int64:
+ val = fmt.Sprint(slice.Index(i).Int())
+ case reflect.Uint, reflect.Uint64:
+ val = fmt.Sprint(slice.Index(i).Uint())
+ case reflect.Float64:
+ val = fmt.Sprint(slice.Index(i).Float())
+ case reflect.Bool:
+ val = fmt.Sprint(slice.Index(i).Bool())
+ case reflectTime:
+ val = slice.Index(i).Interface().(time.Time).Format(time.RFC3339)
+ default:
+ return fmt.Errorf("unsupported type '[]%s'", sliceOf)
+ }
+
+ if i == 0 {
+ keyWithShadows = newKey(key.s, key.name, val)
+ } else {
+ _ = keyWithShadows.AddShadow(val)
+ }
+ }
+ *key = *keyWithShadows
+ return nil
+ }
+
+ var buf bytes.Buffer
+ for i := 0; i < field.Len(); i++ {
+ switch sliceOf {
+ case reflect.String:
+ buf.WriteString(slice.Index(i).String())
+ case reflect.Int, reflect.Int64:
+ buf.WriteString(fmt.Sprint(slice.Index(i).Int()))
+ case reflect.Uint, reflect.Uint64:
+ buf.WriteString(fmt.Sprint(slice.Index(i).Uint()))
+ case reflect.Float64:
+ buf.WriteString(fmt.Sprint(slice.Index(i).Float()))
+ case reflect.Bool:
+ buf.WriteString(fmt.Sprint(slice.Index(i).Bool()))
+ case reflectTime:
+ buf.WriteString(slice.Index(i).Interface().(time.Time).Format(time.RFC3339))
+ default:
+ return fmt.Errorf("unsupported type '[]%s'", sliceOf)
+ }
+ buf.WriteString(delim)
+ }
+ key.SetValue(buf.String()[:buf.Len()-len(delim)])
+ return nil
+}
+
+// reflectWithProperType does the opposite thing as setWithProperType.
+func reflectWithProperType(t reflect.Type, key *Key, field reflect.Value, delim string, allowShadow bool) error {
+ switch t.Kind() {
+ case reflect.String:
+ key.SetValue(field.String())
+ case reflect.Bool:
+ key.SetValue(fmt.Sprint(field.Bool()))
+ case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64:
+ key.SetValue(fmt.Sprint(field.Int()))
+ case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64:
+ key.SetValue(fmt.Sprint(field.Uint()))
+ case reflect.Float32, reflect.Float64:
+ key.SetValue(fmt.Sprint(field.Float()))
+ case reflectTime:
+ key.SetValue(fmt.Sprint(field.Interface().(time.Time).Format(time.RFC3339)))
+ case reflect.Slice:
+ return reflectSliceWithProperType(key, field, delim, allowShadow)
+ case reflect.Ptr:
+ if !field.IsNil() {
+ return reflectWithProperType(t.Elem(), key, field.Elem(), delim, allowShadow)
+ }
+ default:
+ return fmt.Errorf("unsupported type %q", t)
+ }
+ return nil
+}
+
+// CR: copied from encoding/json/encode.go with modifications of time.Time support.
+// TODO: add more test coverage.
+func isEmptyValue(v reflect.Value) bool {
+ switch v.Kind() {
+ case reflect.Array, reflect.Map, reflect.Slice, reflect.String:
+ return v.Len() == 0
+ case reflect.Bool:
+ return !v.Bool()
+ case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64:
+ return v.Int() == 0
+ case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr:
+ return v.Uint() == 0
+ case reflect.Float32, reflect.Float64:
+ return v.Float() == 0
+ case reflect.Interface, reflect.Ptr:
+ return v.IsNil()
+ case reflectTime:
+ t, ok := v.Interface().(time.Time)
+ return ok && t.IsZero()
+ }
+ return false
+}
+
+// StructReflector is the interface implemented by struct types that can extract themselves into INI objects.
+type StructReflector interface {
+ ReflectINIStruct(*File) error
+}
+
+func (s *Section) reflectFrom(val reflect.Value) error {
+ if val.Kind() == reflect.Ptr {
+ val = val.Elem()
+ }
+ typ := val.Type()
+
+ for i := 0; i < typ.NumField(); i++ {
+ if !val.Field(i).CanInterface() {
+ continue
+ }
+
+ field := val.Field(i)
+ tpField := typ.Field(i)
+
+ tag := tpField.Tag.Get("ini")
+ if tag == "-" {
+ continue
+ }
+
+ rawName, omitEmpty, allowShadow, allowNonUnique, extends := parseTagOptions(tag)
+ if omitEmpty && isEmptyValue(field) {
+ continue
+ }
+
+ if r, ok := field.Interface().(StructReflector); ok {
+ return r.ReflectINIStruct(s.f)
+ }
+
+ fieldName := s.parseFieldName(tpField.Name, rawName)
+ if len(fieldName) == 0 || !field.CanSet() {
+ continue
+ }
+
+ if extends && tpField.Anonymous && (tpField.Type.Kind() == reflect.Ptr || tpField.Type.Kind() == reflect.Struct) {
+ if err := s.reflectFrom(field); err != nil {
+ return fmt.Errorf("reflect from field %q: %v", fieldName, err)
+ }
+ continue
+ }
+
+ if (tpField.Type.Kind() == reflect.Ptr && tpField.Type.Elem().Kind() == reflect.Struct) ||
+ (tpField.Type.Kind() == reflect.Struct && tpField.Type.Name() != "Time") {
+ // Note: The only error here is section doesn't exist.
+ sec, err := s.f.GetSection(fieldName)
+ if err != nil {
+ // Note: fieldName can never be empty here, ignore error.
+ sec, _ = s.f.NewSection(fieldName)
+ }
+
+ // Add comment from comment tag
+ if len(sec.Comment) == 0 {
+ sec.Comment = tpField.Tag.Get("comment")
+ }
+
+ if err = sec.reflectFrom(field); err != nil {
+ return fmt.Errorf("reflect from field %q: %v", fieldName, err)
+ }
+ continue
+ }
+
+ if allowNonUnique && tpField.Type.Kind() == reflect.Slice {
+ slice := field.Slice(0, field.Len())
+ if field.Len() == 0 {
+ return nil
+ }
+ sliceOf := field.Type().Elem().Kind()
+
+ for i := 0; i < field.Len(); i++ {
+ if sliceOf != reflect.Struct && sliceOf != reflect.Ptr {
+ return fmt.Errorf("field %q is not a slice of pointer or struct", fieldName)
+ }
+
+ sec, err := s.f.NewSection(fieldName)
+ if err != nil {
+ return err
+ }
+
+ // Add comment from comment tag
+ if len(sec.Comment) == 0 {
+ sec.Comment = tpField.Tag.Get("comment")
+ }
+
+ if err := sec.reflectFrom(slice.Index(i)); err != nil {
+ return fmt.Errorf("reflect from field %q: %v", fieldName, err)
+ }
+ }
+ continue
+ }
+
+ // Note: Same reason as section.
+ key, err := s.GetKey(fieldName)
+ if err != nil {
+ key, _ = s.NewKey(fieldName, "")
+ }
+
+ // Add comment from comment tag
+ if len(key.Comment) == 0 {
+ key.Comment = tpField.Tag.Get("comment")
+ }
+
+ delim := parseDelim(tpField.Tag.Get("delim"))
+ if err = reflectWithProperType(tpField.Type, key, field, delim, allowShadow); err != nil {
+ return fmt.Errorf("reflect field %q: %v", fieldName, err)
+ }
+
+ }
+ return nil
+}
+
+// ReflectFrom reflects section from given struct. It overwrites existing ones.
+func (s *Section) ReflectFrom(v interface{}) error {
+ typ := reflect.TypeOf(v)
+ val := reflect.ValueOf(v)
+
+ if s.name != DefaultSection && s.f.options.AllowNonUniqueSections &&
+ (typ.Kind() == reflect.Slice || typ.Kind() == reflect.Ptr) {
+ // Clear sections to make sure none exists before adding the new ones
+ s.f.DeleteSection(s.name)
+
+ if typ.Kind() == reflect.Ptr {
+ sec, err := s.f.NewSection(s.name)
+ if err != nil {
+ return err
+ }
+ return sec.reflectFrom(val.Elem())
+ }
+
+ slice := val.Slice(0, val.Len())
+ sliceOf := val.Type().Elem().Kind()
+ if sliceOf != reflect.Ptr {
+ return fmt.Errorf("not a slice of pointers")
+ }
+
+ for i := 0; i < slice.Len(); i++ {
+ sec, err := s.f.NewSection(s.name)
+ if err != nil {
+ return err
+ }
+
+ err = sec.reflectFrom(slice.Index(i))
+ if err != nil {
+ return fmt.Errorf("reflect from %dth field: %v", i, err)
+ }
+ }
+
+ return nil
+ }
+
+ if typ.Kind() == reflect.Ptr {
+ val = val.Elem()
+ } else {
+ return errors.New("not a pointer to a struct")
+ }
+
+ return s.reflectFrom(val)
+}
+
+// ReflectFrom reflects file from given struct.
+func (f *File) ReflectFrom(v interface{}) error {
+ return f.Section("").ReflectFrom(v)
+}
+
+// ReflectFromWithMapper reflects data sources from given struct with name mapper.
+func ReflectFromWithMapper(cfg *File, v interface{}, mapper NameMapper) error {
+ cfg.NameMapper = mapper
+ return cfg.ReflectFrom(v)
+}
+
+// ReflectFrom reflects data sources from given struct.
+func ReflectFrom(cfg *File, v interface{}) error {
+ return ReflectFromWithMapper(cfg, v, nil)
+}
diff --git a/vendor/modules.txt b/vendor/modules.txt
@@ -0,0 +1,32 @@
+# github.com/gorilla/mux v1.8.1
+## explicit; go 1.20
+github.com/gorilla/mux
+# github.com/lib/pq v1.12.3
+## explicit; go 1.21
+github.com/lib/pq
+github.com/lib/pq/internal/pgpass
+github.com/lib/pq/internal/pgservice
+github.com/lib/pq/internal/pqsql
+github.com/lib/pq/internal/pqtime
+github.com/lib/pq/internal/pqutil
+github.com/lib/pq/internal/proto
+github.com/lib/pq/oid
+github.com/lib/pq/pqerror
+github.com/lib/pq/scram
+# github.com/schanzen/taler-go v1.5.2
+## explicit; go 1.24.0
+github.com/schanzen/taler-go/pkg/merchant
+github.com/schanzen/taler-go/pkg/rest
+github.com/schanzen/taler-go/pkg/util
+# golang.org/x/text v0.36.0
+## explicit; go 1.25.0
+golang.org/x/text/internal/language
+golang.org/x/text/internal/language/compact
+golang.org/x/text/internal/tag
+golang.org/x/text/language
+# gopkg.in/ini.v1 v1.67.1
+## explicit; go 1.13
+gopkg.in/ini.v1
+# rsc.io/getopt v0.0.0-20170811000552-20be20937449
+## explicit
+rsc.io/getopt
diff --git a/vendor/rsc.io/getopt/LICENSE b/vendor/rsc.io/getopt/LICENSE
@@ -0,0 +1,27 @@
+Copyright (c) 2009 The Go Authors. All rights reserved.
+
+Redistribution and use in source and binary forms, with or without
+modification, are permitted provided that the following conditions are
+met:
+
+ * Redistributions of source code must retain the above copyright
+notice, this list of conditions and the following disclaimer.
+ * Redistributions in binary form must reproduce the above
+copyright notice, this list of conditions and the following disclaimer
+in the documentation and/or other materials provided with the
+distribution.
+ * Neither the name of Google Inc. nor the names of its
+contributors may be used to endorse or promote products derived from
+this software without specific prior written permission.
+
+THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS
+"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT
+LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR
+A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT
+OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL,
+SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT
+LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE,
+DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY
+THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT
+(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE
+OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE.
diff --git a/vendor/rsc.io/getopt/README.md b/vendor/rsc.io/getopt/README.md
@@ -0,0 +1,54 @@
+# rsc.io/getopt
+
+[For full package documentation, see [https://godoc.org/rsc.io/getopt](https://godoc.org/rsc.io/getopt).]
+
+ package getopt // import "rsc.io/getopt"
+
+Package getopt parses command lines using [_getopt_(3)](http://man7.org/linux/man-pages/man3/getopt.3.html) syntax. It is a
+replacement for `flag.Parse` but still expects flags themselves to be defined
+in package flag.
+
+Flags defined with one-letter names are available as short flags (invoked
+using one dash, as in `-x`) and all flags are available as long flags (invoked
+using two dashes, as in `--x` or `--xylophone`).
+
+To use, define flags as usual with [package flag](https://godoc.org/flag). Then introduce any aliases
+by calling `getopt.Alias`:
+
+ getopt.Alias("v", "verbose")
+
+Or call `getopt.Aliases` to define a list of aliases:
+
+ getopt.Aliases(
+ "v", "verbose",
+ "x", "xylophone",
+ )
+
+One name in each pair must already be defined in package flag (so either
+"v" or "verbose", and also either "x" or "xylophone").
+
+Then parse the command-line:
+
+ getopt.Parse()
+
+If it encounters an error, `Parse` calls `flag.Usage` and then exits the
+program.
+
+When writing a custom `flag.Usage` function, call `getopt.PrintDefaults` instead
+of `flag.PrintDefaults` to get a usage message that includes the
+names of aliases in flag descriptions.
+
+At initialization time, package getopt installs a new `flag.Usage` that is the same
+as the default `flag.Usage` except that it calls `getopt.PrintDefaults` instead
+of `flag.PrintDefaults`.
+
+This package also defines a `FlagSet` wrapping the standard `flag.FlagSet`.
+
+## Caveat
+
+In general Go flag parsing is preferred for new programs, because it is not
+as pedantic about the number of dashes used to invoke a flag (you can write
+`-verbose` or `--verbose` and the program does not care). This package is meant
+to be used in situations where, for legacy reasons, it is important to use
+exactly _getopt_(3) syntax, such as when rewriting in Go an existing tool that
+already uses _getopt_(3).
diff --git a/vendor/rsc.io/getopt/getopt.go b/vendor/rsc.io/getopt/getopt.go
@@ -0,0 +1,424 @@
+// Copyright 2017 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package getopt parses command lines using getopt(3) syntax.
+// It is a replacement for flag.Parse but still expects flags themselves
+// to be defined in package flag.
+//
+// Flags defined with one-letter names are available as short flags
+// (invoked using one dash, as in -x) and all flags are available as
+// long flags (invoked using two dashes, as in --x or --xylophone).
+//
+// To use, define flags as usual with package flag. Then introduce
+// any aliases by calling getopt.Alias:
+//
+// getopt.Alias("n", "dry-run")
+// getopt.Alias("v", "verbose")
+//
+// Or call getopt.Aliases to define a list of aliases:
+//
+// getopt.Aliases(
+// "n", "dry-run",
+// "v", "verbose",
+// )
+//
+// One name in each pair must already be defined in package flag
+// (so either "n" or "dry-run", and also either "v" or "verbose").
+//
+// Then parse the command-line:
+//
+// getopt.Parse()
+//
+// If it encounters an error, Parse calls flag.Usage and then exits the program.
+//
+// When writing a custom flag.Usage function, call getopt.PrintDefaults
+// instead of flag.PrintDefaults to get a usage message that includes the
+// names of aliases in flag descriptions.
+//
+// At initialization time, this package installs a new flag.Usage that is the
+// same as the default flag.Usage except that it calls getopt.PrintDefaults
+// instead of flag.PrintDefaults.
+//
+// This package also defines a FlagSet wrapping the standard flag.FlagSet.
+//
+// Caveat
+//
+// In general Go flag parsing is preferred for new programs, because
+// it is not as pedantic about the number of dashes used to invoke
+// a flag (you can write -verbose or --verbose and the program
+// does not care). This package is meant to be used in situations
+// where, for legacy reasons, it is important to use exactly getopt(3)
+// syntax, such as when rewriting in Go an existing tool that already
+// uses getopt(3).
+package getopt // import "rsc.io/getopt"
+
+import (
+ "flag"
+ "fmt"
+ "io"
+ "os"
+ "reflect"
+ "strings"
+ "unicode/utf8"
+)
+
+func init() {
+ flag.Usage = func() {
+ fmt.Fprintf(os.Stderr, "Usage of %s:\n", os.Args[0])
+ PrintDefaults() // ours not package flag's
+ }
+
+ CommandLine.FlagSet = flag.CommandLine
+ CommandLine.name = os.Args[0]
+ CommandLine.errorHandling = flag.ExitOnError
+ CommandLine.outw = os.Stderr
+ CommandLine.Usage = func() { flag.Usage() }
+}
+
+var CommandLine FlagSet
+
+// A FlagSet is a set of defined flags.
+// It wraps and provides the same interface as flag.FlagSet
+// but parses command line arguments using getopt syntax.
+//
+// Note that "go doc" shows only the methods customized
+// by package getopt; FlagSet also provides all the methods
+// of the embedded flag.FlagSet, like Bool, Int, NArg, and so on.
+type FlagSet struct {
+ *flag.FlagSet
+
+ alias map[string]string
+ unalias map[string]string
+ name string
+ errorHandling flag.ErrorHandling
+ outw io.Writer
+}
+
+func (f *FlagSet) out() io.Writer {
+ if f.outw == nil {
+ return os.Stderr
+ }
+ return f.outw
+}
+
+// SetOutput sets the destination for usage and error messages.
+// If output is nil, os.Stderr is used.
+func (f *FlagSet) SetOutput(output io.Writer) {
+ f.FlagSet.SetOutput(output)
+ f.outw = output
+}
+
+// NewFlagSet returns a new, empty flag set with the specified name and error
+// handling property.
+func NewFlagSet(name string, errorHandling flag.ErrorHandling) *FlagSet {
+ f := new(FlagSet)
+ f.Init(name, errorHandling)
+ return f
+}
+
+// Init sets the name and error handling proprety for a flag set.
+func (f *FlagSet) Init(name string, errorHandling flag.ErrorHandling) {
+ if f.FlagSet == nil {
+ f.FlagSet = new(flag.FlagSet)
+ }
+ f.FlagSet.Init(name, errorHandling)
+ f.name = name
+ f.errorHandling = errorHandling
+ f.FlagSet.Usage = f.defaultUsage
+}
+
+func (f *FlagSet) init() {
+ if f.alias == nil {
+ f.alias = make(map[string]string)
+ f.unalias = make(map[string]string)
+ }
+}
+
+// Lookup returns the Flag structure of the named flag,
+// returning nil if none exists.
+// If name is a defined alias for a defined flag,
+// Lookup returns the original flag; in this case
+// the Name field in the result will differ from the
+// name passed to Lookup.
+func (f *FlagSet) Lookup(name string) *flag.Flag {
+ if x, ok := f.alias[name]; ok {
+ name = x
+ }
+ return f.FlagSet.Lookup(name)
+}
+
+// Alias introduces an alias for an existing flag name.
+// The short name must be a single letter, and the long name must be multiple letters.
+// Exactly one name must be defined as a flag already: the undefined name is introduced
+// as an alias for the defined name.
+// Alias panics if both names are already defined or if both are undefined.
+//
+// For example, if a flag named "v" is already defined using package flag,
+// then it is available as -v (or --v). Calling Alias("v", "verbose") makes the same
+// flag also available as --verbose.
+func Alias(short, long string) {
+ CommandLine.Alias(short, long)
+}
+
+// Alias introduces an alias for an existing flag name.
+// The short name must be a single letter, and the long name must be multiple letters.
+// Exactly one name must be defined as a flag already: the undefined name is introduced
+// as an alias for the defined name.
+// Alias panics if both names are already defined or if both are undefined.
+//
+// For example, if a flag named "v" is already defined using package flag,
+// then it is available as -v (or --v). Calling Alias("v", "verbose") makes the same
+// flag also available as --verbose.
+func (f *FlagSet) Alias(short, long string) {
+ f.init()
+ if short == "" || long == "" {
+ panic("Alias: invalid empty flag name")
+ }
+ if utf8.RuneCountInString(short) != 1 {
+ panic("Alias: invalid short flag name -" + short)
+ }
+ if utf8.RuneCountInString(long) == 1 {
+ panic("Alias: invalid long flag name --" + long)
+ }
+
+ f1 := f.Lookup(short)
+ f2 := f.Lookup(long)
+ if f1 == nil && f2 == nil {
+ panic("Alias: neither -" + short + " nor -" + long + " is a defined flag")
+ }
+ if f1 != nil && f2 != nil {
+ panic("Alias: both -" + short + " and -" + long + " are defined flags")
+ }
+
+ if f1 != nil {
+ f.alias[long] = short
+ f.unalias[short] = long
+ } else {
+ f.alias[short] = long
+ f.unalias[long] = short
+ }
+}
+
+// Aliases introduces zero or more aliases. The argument list must consist of an
+// even number of strings making up a sequence of short, long pairs to be passed
+// to Alias.
+func Aliases(list ...string) {
+ CommandLine.Aliases(list...)
+}
+
+// Aliases introduces zero or more aliases. The argument list must consist of an
+// even number of strings making up a sequence of short, long pairs to be passed
+// to Alias.
+func (f *FlagSet) Aliases(list ...string) {
+ if len(list)%2 != 0 {
+ panic("getopt: Aliases not invoked with pairs")
+ }
+ for i := 0; i < len(list); i += 2 {
+ f.Alias(list[i], list[i+1])
+ }
+}
+
+type boolFlag interface {
+ IsBoolFlag() bool
+}
+
+func (f *FlagSet) failf(format string, args ...interface{}) error {
+ err := fmt.Errorf(format, args...)
+ fmt.Fprintln(f.out(), err)
+ f.Usage()
+ return err
+}
+
+// defaultUsage is the default function to print a usage message.
+func (f *FlagSet) defaultUsage() {
+ if f.name == "" {
+ fmt.Fprintf(f.out(), "Usage:\n")
+ } else {
+ fmt.Fprintf(f.out(), "Usage of %s:\n", f.name)
+ }
+ f.PrintDefaults()
+}
+
+// Parse parses the command-line flags from os.Args[1:].
+func Parse() {
+ CommandLine.Parse(os.Args[1:])
+}
+
+// Parse parses flag definitions from the argument list,
+// which should not include the command name.
+// Parse must be called after all flags and aliases in the FlagSet are defined
+// and before flags are accessed by the program.
+// The return value will be flag.ErrHelp if -h or --help were used but not defined.
+func (f *FlagSet) Parse(args []string) error {
+ for len(args) > 0 {
+ arg := args[0]
+ if len(arg) < 2 || arg[0] != '-' {
+ break
+ }
+ args = args[1:]
+ if arg[:2] == "--" {
+ // Process single long option.
+ if arg == "--" {
+ break
+ }
+ name := arg[2:]
+ value := ""
+ haveValue := false
+ if i := strings.Index(name, "="); i >= 0 {
+ name, value = name[:i], name[i+1:]
+ haveValue = true
+ }
+ fg := f.Lookup(name)
+ if fg == nil {
+ if name == "h" || name == "help" {
+ // TODO ErrHelp
+ }
+ return f.failf("flag provided but not defined: --%s", name)
+ }
+ if b, ok := fg.Value.(boolFlag); ok && b.IsBoolFlag() {
+ if haveValue {
+ if err := fg.Value.Set(value); err != nil {
+ return f.failf("invalid boolean value %q for --%s: %v", value, name, err)
+ }
+ } else {
+ if err := fg.Value.Set("true"); err != nil {
+ return f.failf("invalid boolean flag %s: %v", name, err)
+ }
+ }
+ continue
+ }
+ if !haveValue {
+ if len(args) == 0 {
+ return f.failf("missing argument for --%s", name)
+ }
+ value, args = args[0], args[1:]
+ }
+ if err := fg.Value.Set(value); err != nil {
+ return f.failf("invalid value %q for flag --%s: %v", value, name, err)
+ }
+ continue
+ }
+
+ // Process one or more short options.
+ for arg = arg[1:]; arg != ""; {
+ r, size := utf8.DecodeRuneInString(arg)
+ if r == utf8.RuneError && size == 1 {
+ return f.failf("invalid UTF8 in command-line flags")
+ }
+ name := arg[:size]
+ arg = arg[size:]
+ fg := f.Lookup(name)
+ if fg == nil {
+ if name == "h" {
+ // TODO ErrHelp
+ }
+ return f.failf("flag provided but not defined: -%s", name)
+ }
+ if b, ok := fg.Value.(boolFlag); ok && b.IsBoolFlag() {
+ if err := fg.Value.Set("true"); err != nil {
+ return f.failf("invalid boolean flag %s: %v", name, err)
+ }
+ continue
+ }
+ if arg == "" {
+ if len(args) == 0 {
+ return f.failf("missing argument for -%s", name)
+ }
+ arg, args = args[0], args[1:]
+ }
+ if err := fg.Value.Set(arg); err != nil {
+ return f.failf("invalid value %q for flag -%s: %v", arg, name, err)
+ }
+ break // consumed arg
+ }
+ }
+
+ // Arrange for flag.NArg, flag.Args, etc to work properly.
+ f.FlagSet.Parse(append([]string{"--"}, args...))
+ return nil
+}
+
+// PrintDefaults is like flag.PrintDefaults but includes information
+// about short/long alias pairs and prints the correct syntax for
+// long flags.
+func PrintDefaults() {
+ CommandLine.PrintDefaults()
+}
+
+// PrintDefaults is like flag.PrintDefaults but includes information
+// about short/long alias pairs and prints the correct syntax for
+// long flags.
+func (f *FlagSet) PrintDefaults() {
+ f.FlagSet.VisitAll(func(fg *flag.Flag) {
+ name := fg.Name
+ short, long := "", ""
+ other := f.unalias[name]
+ if utf8.RuneCountInString(name) > 1 {
+ long, short = name, other
+ } else {
+ short, long = name, other
+ }
+ var s string
+ if short != "" {
+ s = fmt.Sprintf(" -%s", short) // Two spaces before -; see next two comments.
+ if long != "" {
+ s += ", --" + long
+ }
+ } else {
+ s = fmt.Sprintf(" --%s", long) // Two spaces before -; see next two comments.
+ }
+ name, usage := flag.UnquoteUsage(fg)
+ if len(name) > 0 {
+ s += " " + name
+ }
+
+ // Boolean flags of one ASCII letter are so common we
+ // treat them specially, putting their usage on the same line.
+ if len(s) <= 4 { // space, space, '-', 'x'.
+ s += "\t"
+ } else {
+ // Four spaces before the tab triggers good alignment
+ // for both 4- and 8-space tab stops.
+ s += "\n \t"
+ }
+ s += usage
+ if !isZeroValue(fg, fg.DefValue) {
+ if strings.HasSuffix(reflect.TypeOf(fg.Value).String(), "stringValue") {
+ // put quotes on the value
+ s += fmt.Sprintf(" (default %q)", fg.DefValue)
+ } else {
+ s += fmt.Sprintf(" (default %v)", fg.DefValue)
+ }
+ }
+ fmt.Fprint(f.out(), s, "\n")
+ })
+}
+
+// isZeroValue guesses whether the string represents the zero
+// value for a flag. It is not accurate but in practice works OK.
+func isZeroValue(f *flag.Flag, value string) bool {
+ // Build a zero value of the flag's Value type, and see if the
+ // result of calling its String method equals the value passed in.
+ // This works unless the Value type is itself an interface type.
+ typ := reflect.TypeOf(f.Value)
+ var z reflect.Value
+ if typ.Kind() == reflect.Ptr {
+ z = reflect.New(typ.Elem())
+ } else {
+ z = reflect.Zero(typ)
+ }
+ if value == z.Interface().(flag.Value).String() {
+ return true
+ }
+
+ switch value {
+ case "false":
+ return true
+ case "":
+ return true
+ case "0":
+ return true
+ }
+ return false
+}
